KEGG   Ochrobactrum pseudogrignonense: A8A54_09015Help
Entry
A8A54_09015       CDS       T04415                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00071  Fatty acid degradation
ops00072  Synthesis and degradation of ketone bodies
ops00280  Valine, leucine and isoleucine degradation
ops00310  Lysine degradation
ops00362  Benzoate degradation
ops00380  Tryptophan metabolism
ops00620  Pyruvate metabolism
ops00630  Glyoxylate and dicarboxylate metabolism
ops00640  Propanoate metabolism
ops00650  Butanoate metabolism
ops00900  Terpenoid backbone biosynthesis
ops01100  Metabolic pathways
ops01110  Biosynthesis of secondary metabolites
ops01120  Microbial metabolism in diverse environments
ops01130  Biosynthesis of antibiotics
ops01200  Carbon metabolism
ops01212  Fatty acid metabolism
ops02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A8A54_09015
   00630 Glyoxylate and dicarboxylate metabolism
    A8A54_09015
   00640 Propanoate metabolism
    A8A54_09015
   00650 Butanoate metabolism
    A8A54_09015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A8A54_09015
   00072 Synthesis and degradation of ketone bodies
    A8A54_09015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A8A54_09015
   00310 Lysine degradation
    A8A54_09015
   00380 Tryptophan metabolism
    A8A54_09015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A8A54_09015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A8A54_09015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A8A54_09015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ops04147]
    A8A54_09015
Enzymes [BR:ops01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A8A54_09015
Exosome [BR:ops04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A8A54_09015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANG96608
UniProt: A0A1A9FLL5
Position
1:complement(1877915..1879108)
Genome map
AA seq 397 aa AA seqDB search
MTASQSQKAIIIASAARTAVGAFNGAFANVAAHELGATAIKAALERAGVDAADVDEVILG
QVLTAGEGQNPARQAAMAAGCPKETTAFSINQLCGSGLRAVALGMQQILSGDAKIIVAGG
QESMSMAPHCAHLRSGVKMGDFKMIDTMIKDGLTDAFNGYHMGITAENIAKQWQLSRDDQ
DQFALASQNKAEAAQTAGRFEDEIVPFAVKSRKGETIVSADEYIRVGATIEALTKLKPAF
DKEGTVTAGNASGINDGAAAVVLMDADEAAKRGVEPLARIVSWATAGVDPSIMGTGPIPA
TRKALEKAGWTVADLELVEANEAFAAQSCAVVRDLGINPEIVNVNGGAIAIGHPIGASGA
RVLTTLLYEMKRRGAKRGLATLCIGGGMGVAMCVERS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatcgcaaagccagaaagccataattattgccagcgcagcccgaacagcggtg
ggcgcgtttaatggcgctttcgcaaatgtggctgcgcatgaactgggcgctactgcaatc
aaggcagctcttgagcgcgcaggcgtggatgctgctgatgtggatgaagtcattctcggt
caggtgctgacggcaggcgaggggcagaacccggcacgacaggctgcgatggccgcagga
tgccccaaggaaacgactgcattctcgatcaaccagctttgtgggtcaggcctgcgtgcc
gtcgcactcggtatgcagcagattctgtcgggcgatgcgaagatcattgtggcaggtggt
caggaatcgatgtccatggcaccccattgcgcgcatttgcgttccggcgtgaagatgggc
gacttcaagatgatcgatacgatgatcaaggatggcctgacggatgccttcaatggctac
catatggggatcaccgcagaaaacatcgccaagcagtggcagctcagccgcgatgatcag
gatcaattcgcattggcatcgcaaaacaaggccgaagctgcacagaccgcaggtcgtttc
gaggatgagattgttccgtttgccgtaaagagccgcaaaggcgagacgattgtatctgct
gatgaatatatccgcgttggtgcaacaatcgaggcgctgacaaagctcaaacctgccttt
gacaaggaaggcacggttacggctggcaatgcatccggcattaatgacggtgcggcggct
gttgtcctgatggatgcggatgaagccgcaaaacgcggtgtcgagccgctcgcgcgcatt
gtttcgtgggcaacggcgggtgtcgatccatcgatcatggggactggaccaattcctgct
acccgcaaagcgcttgaaaaagctgggtggacggttgctgatctggaactggttgaagcg
aatgaagcctttgcagctcaatcctgtgctgtcgttcgcgatcttggtattaatccagag
atcgtgaacgtcaatggtggtgcaattgcgattggccatccgatcggtgcgtccggtgcg
cgtgtgctgacgaccctgctatatgaaatgaagcgtcgtggcgcaaaacgcggacttgca
acgctttgcatcggtggcggcatgggtgtcgctatgtgcgttgagcggtcgtaa

DBGET integrated database retrieval system