KEGG   Ochrobactrum pseudogrignonense: A8A54_17590Help
Entry
A8A54_17590       CDS       T04415                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ops  Ochrobactrum pseudogrignonense
Pathway
ops00010  Glycolysis / Gluconeogenesis
ops00020  Citrate cycle (TCA cycle)
ops00620  Pyruvate metabolism
ops01100  Metabolic pathways
ops01110  Biosynthesis of secondary metabolites
ops01120  Microbial metabolism in diverse environments
ops01130  Biosynthesis of antibiotics
ops01200  Carbon metabolism
Module
ops_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ops00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A8A54_17590
   00020 Citrate cycle (TCA cycle)
    A8A54_17590
   00620 Pyruvate metabolism
    A8A54_17590
Enzymes [BR:ops01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     A8A54_17590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ANG98131
UniProt: A0A1A9FQJ9
Position
1:complement(3770083..3771693)
Genome map
AA seq 536 aa AA seqDB search
MKEIGIHNTAASIATSGLKELSAVFYNFGPARLYEETIRRGEAELSAQGALVARTGQHTG
RSPKDKFVVRDANTEDQVWWDNNKPMTPEAFELLYADFIEHAKGKELFVQDLIGGADEDN
KINARVVTEYAWHSLFIRNLLIRPEEAALASYVPEMTIIDLPSFKADPARYGVRTETVIA
VDLTRKIVLIGGTSYAGEMKKSVFTALNYLLPAKGVMPMHCSANEGPNGDTAVFFGLSGT
GKTTLSADPTRTLIGDDEHGWGEDGVFNFEGGCYAKTIRLSAEAEPEIYATTQRFGTVLE
NVVLDANRQPDFDDVSLTENTRCAYPLDFIPNASSTGKGGQPKNIIMLTADAFGVMPPIA
KLTPAQAMYHFLSGYTAKVAGTEKGVTEPEATFSTCFGAPFMPRHPSEYGNLLRKLIAEH
KVDCWLVNTGWTGGAYGTGKRMPIKATRALLAAALDGSLNNAEFRTDPNFGFAVPVEVPG
VDTSILDPRSTWADKAAYDAQAQKLVDMFVNNFEKFESHVDHDVRDAAPATQIAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagatcggcattcacaatactgccgcttccattgccacttcaggattgaaggaa
ctgtccgcagtcttttataattttggaccggcccggctttatgaagagactattcgccgt
ggcgaagcagagctttcagcacaaggagcccttgttgctagaacgggccagcacactggc
cgttcgccaaaagacaaattcgtggttcgcgatgcaaacaccgaagatcaggtctggtgg
gacaacaacaagccaatgacgccggaggctttcgagcttctctatgccgatttcatcgaa
catgcgaagggcaaggagcttttcgtacaggatctcatcggcggcgcagacgaagacaac
aagatcaacgcgcgtgttgtcactgaatatgcatggcactcgctgttcatccgcaacttg
ctgatccgtccggaagaagcagcgcttgcttcttacgtgcctgaaatgaccattatcgat
ctgccttccttcaaggccgatcctgcacgctatggtgtgcgcaccgaaacggtgatcgca
gtcgatcttacccgcaagatcgtgctgatcggcggcacttcctatgctggtgaaatgaag
aagtcggtcttcaccgcgctcaactatcttctgcctgccaagggcgtcatgccaatgcat
tgctcggccaatgaaggcccgaacggcgacacggctgtcttcttcggtctgtccggcact
ggcaagaccacgctttcggctgatccgacccgcacgctgatcggcgatgacgagcacggc
tggggcgaagatggcgtcttcaatttcgaaggcggctgctatgccaagaccattcgtttg
tcagctgaagccgagccggaaatctacgcaaccacgcagcgcttcggcactgtgctggaa
aatgttgtgctggatgcaaaccgccagccggatttcgatgacgtatcgctgactgaaaac
acccgctgcgcctatccgctcgacttcatcccgaatgcatcatcgacgggcaagggcggt
cagccaaagaacatcatcatgcttaccgctgatgccttcggcgtcatgcctccgattgcc
aagcttacgcctgcgcaggccatgtatcacttcctgtcaggctacaccgccaaggttgcc
ggtaccgaaaagggcgtgaccgagcctgaagcaacgttctcgacctgctttggtgcgcca
ttcatgccgcgccatccatcggaatacggcaatctgctgcgcaagctgatcgccgaacac
aaggtcgattgctggctggtcaacaccggctggaccggcggcgcttatggcaccggcaag
cgtatgccgatcaaggctacccgtgcgcttcttgcagcagcgctcgacggttcgctcaac
aatgcggaattccgtactgatccgaatttcggcttcgccgtgccggttgaagtaccgggc
gtggatacgtccattctcgatccgcgttcgacctgggctgacaaggcagcttacgacgca
caggctcaaaaacttgtcgatatgttcgtgaacaatttcgagaagttcgaaagccatgtc
gatcatgatgtacgcgatgcagcgccagcaacgcaaattgctgctgaataa

DBGET integrated database retrieval system