KEGG   Ornithobacterium rhinotracheale DSM 15997: Ornrh_1509Help
Entry
Ornrh_1509        CDS       T02145                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
orh  Ornithobacterium rhinotracheale DSM 15997
Pathway
orh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
orh01100  Metabolic pathways
orh01110  Biosynthesis of secondary metabolites
orh01130  Biosynthesis of antibiotics
orh01230  Biosynthesis of amino acids
Module
orh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:orh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ornrh_1509
Enzymes [BR:orh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ornrh_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFL97675
UniProt: I4A141
Position
1542409..1543188
Genome map
AA seq 259 aa AA seqDB search
MSILDKIVAHKKEEIEFEKRRISVEELMDRKHFHRKSMNFAWHLKEDPFGIIAEFKRKSP
SKSDINIGAKVEDIVPIYKACGAACVSVLTDSHFFGGSLEDLKNARKYGLPLLRKDFILD
PYQLYQAKAFGADAVLLIANILERNQIKDLTDYAKDLGLQVLLEFYGGEDFSKYYNKVKM
VGINNRNLNTFEVDYQHAIRMRNELPAEVLSVAESAIYSPEIYLELKKNGFDAFLMGEYF
MKTNQPEETFKNFIQAIQP
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcattttagataaaatcgtagcgcataaaaaggaggaaatcgaattcgagaaacga
agaatctcggtagaagaattgatggatcgcaagcattttcatcgcaagagcatgaatttt
gcttggcatttaaaagaagatccatttgggatcattgccgaatttaaaagaaaatctccg
tccaaaagcgatatcaatattggggcaaaagtagaagatattgtcccgatttataaagca
tgcggggctgcttgtgtttcggtgctcacagattcgcatttctttggcggcagtttggag
gatttaaaaaatgcccgaaaatacggtttgcctttgttgcgcaaagactttattttagat
ccgtatcaattatatcaagccaaagcctttggtgcagacgccgttttgctaattgctaat
attttagaacgaaatcaaatcaaggatttaaccgattatgccaaggatttaggattgcaa
gttttgcttgaattttatggtggagaggatttctcaaaatattataacaaagtgaaaatg
gtaggcatcaataaccgaaatttaaacacttttgaggtagattatcagcacgcaattcgt
atgcgaaacgagttgccagccgaggttttgagcgtggctgaaagtgctatttactcgccc
gagatttatttggaattaaaaaagaatggttttgatgcatttttgatgggcgaatatttt
atgaaaacgaaccagccagaagagacttttaaaaactttatccaagcgattcaaccatga

DBGET integrated database retrieval system