KEGG   Ornithobacterium rhinotracheale ORT-UMN 88: Q785_10220Help
Entry
Q785_10220        CDS       T03303                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
ori  Ornithobacterium rhinotracheale ORT-UMN 88
Pathway
ori00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ori00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Q785_10220
Enzymes [BR:ori01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     Q785_10220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Sacchrp_dh_NADP AdoHcyase_NAD 2-Hacid_dh_C 3Beta_HSD THF_DHG_CYH_C Oxidored_nitro 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AIP99943
Position
2060693..2061472
Genome map
AA seq 259 aa AA seqDB search
MDTKKFFDLSGKTAIVTGGANGIGKACCEVLAAFGAKVVVADYDLETAKKTAQEIEQSGG
KAIAIKCDNFKDEDLVNLVEETVKQFGSLEILVNNVGGGGGGKESPYKIEVGQFKKVFEM
NVFSTWRLCQLVAPHMEKSGYGSIINMSSMASINKSPAISAYASSKAAINHMTRNLAYDY
GPANIRVNAVGPGATRTHALSTVLTPEIEKAMLKHTPIHRLGEPEDIAGAVLYFASPISS
WVSGQVIFVNGGGEQTLDM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggataccaaaaaattctttgatctaagtggcaaaacagccattgttacaggaggtgcc
aacggaatcggcaaagcgtgttgcgaagttttagccgctttcggtgccaaagtagtcgtg
gcggattatgacctagaaactgcgaaaaaaacggctcaagaaattgaacaatctggcgga
aaggcaattgccataaaatgtgataacttcaaagacgaagatttagtaaatctcgtggag
gaaaccgtgaaacaatttggcagtttagaaatcctcgtcaataatgttggcggtggaggc
ggaggcaaggaaagcccttacaaaatcgaggtagggcagttcaaaaaagtatttgaaatg
aatgtttttagtacatggcgactttgccagcttgtggctcctcatatggaaaaaagcggc
tacggaagtatcatcaatatgtcgtctatggcttcgatcaataaaagtccagccatcagt
gcttatgcttcttccaaagcggcgattaatcacatgacgcgcaatttggcatacgactat
ggacctgccaatattcgtgtaaacgcagtgggacctggtgccactcgcacccacgcattg
agcacggtgctcacgcccgaaatcgaaaaagcgatgttgaagcatacaccaatccatcgt
ttgggagagccagaagatattgcgggagcggtactctactttgcatcgcctatctcaagc
tgggtgagcggacaagtcatctttgtgaatggtgggggcgaacaaactttagatatgtaa

DBGET integrated database retrieval system