KEGG   Ornithinimicrobium sp. AMA3305: DV701_11835Help
Entry
DV701_11835       CDS       T05559                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00030  Pentose phosphate pathway
orn00480  Glutathione metabolism
orn01100  Metabolic pathways
orn01110  Biosynthesis of secondary metabolites
orn01120  Microbial metabolism in diverse environments
orn01130  Biosynthesis of antibiotics
orn01200  Carbon metabolism
Module
orn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
orn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DV701_11835 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DV701_11835 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:orn04147]
    DV701_11835 (zwf)
Enzymes [BR:orn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     DV701_11835 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     DV701_11835 (zwf)
Exosome [BR:orn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DV701_11835 (zwf)
  Exosomal proteins of colorectal cancer cells
   DV701_11835 (zwf)
  Exosomal proteins of bladder cancer cells
   DV701_11835 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AXH96715
UniProt: A0A345NNV7
Position
complement(2578733..2580328)
Genome map
AA seq 531 aa AA seqDB search
MRCRRATRPRAPYGTGRHPGSSPARLAEVTAWTDPLTQTTSYPGLGPATQTEEIAEPHVI
VLFGARGDLSRRKLLPGLAYLCSSDLAPKIRVVGSSLEEFDDAEFREFAREALAEFGHRQ
LGEQEWGAFADNLRYVPTSAGAAGLARVVAEERAALGQRSGLLHYLSVPPSAALSVIGLL
READLVEGSRIVMEKPFGTDLASAVHLNASVHETFDEDQIFRIDHFLGKEAAQNILAFRF
ANGLFEPIWNRNFIDHVQIDIPETLGLERRAGFYEATGAYKDMVVTHLFQVLAFVAMEPP
TALEPTAIGEEKNKVFRSMLPLDPARVVRGQYVGYLDEEGVARDSDTETFIALRCEIDNW
RWAGVPFYLRTGKRMAEGARIISIAFKEAPRTMFPAHSGVGQAGPDHLTFDLADESKVSL
SFYGKRPGPGMRLEKLSMQFSTQETAAAGDVLEAYERLILDAMRGDHTLFTTAEGIESLW
ARSGPLLQSPPPVKPYPAGTWGPNAIHQLIAPHAWRLPFERTWRDHTPTGG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgtcgacgggccacgcggccccgcgcaccgtacggcaccggtcgacaccccggg
tcgtcgcctgccagactcgcggaggtgaccgcctggaccgacccgctgacccagaccacc
tcataccccggtctcgggccggccacgcagaccgaggagatcgccgaaccgcacgtgatc
gtgctcttcggcgcccgcggcgacctctcccggcgcaagctgctgccggggctggcctac
ctgtgcagctcggacctggcgccgaagatccgggtggtgggcagctcgctggaggagttc
gacgacgcggagttccgggagttcgcccgggaggcgctcgccgagttcggccaccggcag
ctgggcgagcaggagtggggcgccttcgccgacaacctccggtacgtcccgacgagcgcc
ggcgccgccgggctggcgcgggtcgtggcagaggagcgggccgccctcgggcagcggtcc
ggtctgctgcactacctcagcgtcccgcccagcgcggccctgtcggtcatcgggctgctg
cgcgaggccgacctggtggagggctcgcggatcgtcatggagaagcccttcggcaccgac
ctggccagcgcggtccacctcaacgccagcgtccacgagaccttcgacgaggaccagatc
ttccggatcgaccacttcctgggcaaggaggcggcccagaacatcctcgccttccgcttc
gccaacgggctgttcgagccgatctggaaccgcaacttcatcgaccacgtgcagatcgac
atacccgagaccctcggcctggagcgacgggccggcttctacgaggcgaccggcgcctac
aaggacatggtggtgacccacctgttccaggtcctggcgttcgtggcgatggagccgccg
accgccctggagccgaccgcgatcggcgaggagaagaacaaggtcttccgctcgatgctg
ccgctggaccccgcgcgggtggtgcgcggccagtacgtcggctacctggacgaggagggc
gtcgcgcgcgactcggacaccgagaccttcatcgcgctgcgctgcgagatcgacaactgg
cgctgggcgggcgtgccgttctacctgcgcaccggcaagcggatggccgagggtgcgcgc
atcatctcgatcgcgttcaaggaggcgccacgcacgatgttcccggcgcactccggcgtg
gggcaggccgggccggaccacctgaccttcgacctggccgacgagtccaaggtctcgctg
tctttctacggcaagcgccccggccccgggatgcgcctggagaagctctcgatgcagttc
tccacccaggagaccgcggccgccggggacgtcctcgaggcctacgaacggctcatcctg
gacgcgatgcgaggcgaccacacgctgttcaccacggccgagggcatcgagagcctgtgg
gcccgctcgggcccgctgctgcagagccccccgccggtgaagccctacccggcggggacc
tggggacccaacgccatccaccagctgatcgcgccgcacgcctggcggctgcccttcgag
cggacctggcgcgaccacaccccgacgggtgggtga

DBGET integrated database retrieval system