KEGG   Ornithinimicrobium sp. AMA3305: DV701_15220Help
Entry
DV701_15220       CDS       T05559                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
orn  Ornithinimicrobium sp. AMA3305
Pathway
orn00450  Selenocompound metabolism
orn00970  Aminoacyl-tRNA biosynthesis
orn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:orn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DV701_15220
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DV701_15220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:orn01007]
    DV701_15220
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:orn03016]
    DV701_15220
Enzymes [BR:orn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DV701_15220
Amino acid related enzymes [BR:orn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DV701_15220
Transfer RNA biogenesis [BR:orn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DV701_15220
 Prokaryotic type
   Other AARSs
    DV701_15220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f zf-ribbon_3
Motif
Other DBs
NCBI-ProteinID: AXH97285
UniProt: A0A345NQH7
Position
3317090..3318913
Genome map
AA seq 607 aa AA seqDB search
MTHVLTSVAWPYANGPRHIGHVAGFGVPSDVFSRYMRMAGHDVLMVSGSDEHGTPILVQA
DKAGMTPQEFIDVNHRLIAEDLVALGVSYDLYTRTTTANHHQVVQQMFLACYANGYMVEQ
TQLVAISPSTGRTLPDRFIEGTCPICGYAEARGDQCDNCGNQLDPTDLIEPHSKINGETP
EFKDTQHFFLDLPALAEALGEWLDGREASGLWRPNVIRFSTNILQEIRPRAMTRDIDWGI
TVPLPGWAEHPTKKLYVWFDAVIGYLSASVEWARRLGDGHEERWRDWWNDPEALSYYFMG
KDNITFHSQIWPAEMLAHNGEGSRGGEQGPFGHLNLPTEVVSSEFLTMEGKQFSTSRSIV
IYVRDVLDRYQPDALRYFLSAAAPETHDSDFSWPEFLKRTNTELVAGWGNLVNRTASMIA
KNFGQVPAAGELEDVDRALLEQVRAGFGAVGGLIGAHKQKAGLAEAMRLVGEANAYVSTT
EPFKLKGEDQRERLGTVLHVLAQAVVDLNTILSPYLPHSSTAVHHALGGEGIFQPMPQIQ
EVSDLDDPSIGDYPVITGDYTSAPRWEHRPVTVGAPVAKPSPIFTKLDPSVVEEERARLG
LVDGAGV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgtcctgacctccgtcgcctggccgtacgccaacggtccgcgccacatcggc
cacgtcgccggcttcggcgtcccgtccgacgtcttcagcaggtacatgcggatggccggc
cacgacgtgctcatggtcagcggctccgacgagcacggcacgccgatcctggtgcaggcc
gacaaggcggggatgacgccgcaggagttcatcgacgtcaaccaccggctcatcgccgag
gacctcgtcgctctcggggtctcctacgacctctacacgcgcaccacgacggccaaccac
caccaggtcgtgcagcagatgttcctggcctgctacgccaacggctacatggtcgagcag
acgcagctggtggcgatcagcccctcgaccggccgcacgctgccggaccgcttcatcgag
ggcacctgcccgatctgcggctacgccgaggcgcgcggcgaccagtgcgacaactgcggc
aaccagctggaccccaccgacctgatcgagccgcactccaagatcaacggcgagacgccg
gagttcaaggacacccagcacttcttcctcgacctgccggcgctcgccgaggccctgggg
gagtggctggacgggcgcgaggccagtgggctgtggcgccccaacgtcatccgcttctcc
acgaacatcctgcaggagatccgcccgcgcgcgatgacgcgcgacatcgactgggggatc
accgtcccgctgccggggtgggcggagcacccgaccaagaagctctacgtgtggttcgac
gcggtcatcggctacctctcggcgtccgtcgagtgggcccggcggctcggggacggccac
gaggagcggtggcgcgactggtggaacgacccggaggcgctgtcctactacttcatgggc
aaggacaacatcaccttccactcccagatctggccggcggagatgctcgcgcacaacggg
gagggcagcagaggcggtgagcagggccccttcggccacctcaacctgcccaccgaggtc
gtctccagcgagttcctcacgatggagggcaagcagttctccacctcgcgctcgatcgtc
atctacgtccgcgacgtgctggaccgctaccagcccgacgcgctgcgctacttcctctcc
gccgccgcgcccgagacgcacgactccgacttctcctggccggagttcctcaagcgcacg
aacaccgagctcgtcgcgggttggggcaacctggtcaaccgcaccgcttcgatgatcgcc
aagaacttcgggcaggtccctgccgcgggcgagctcgaggacgtcgaccgggcgctgctg
gagcaggtccgcgccgggttcggcgccgtcggcggcctcatcggtgcccacaagcagaag
gcggggctggccgaggcgatgcgcctggtcggtgaggccaacgcctacgtctccacgacc
gagccgttcaagctcaagggggaggaccagcgcgagcgtctcggcacggtgctgcacgtg
ctcgcccaggcggtcgtcgacctcaacaccatcctctcgccctacctgccgcacagctcg
accgcggtccaccacgcgctgggaggcgagggcatcttccagccgatgccgcagatccag
gaggtcagcgacctggacgacccgtcgatcggcgattatccggtcatcaccggcgactac
acctcggcgccccgctgggagcaccgccccgtcaccgtgggcgcgcccgtggccaagccg
tcgccgatcttcaccaagctcgacccgtcggtggtcgaggaggagcgggcgcggctcggg
ctggtcgacggggccggggtatga

DBGET integrated database retrieval system