KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362262Help
Entry
101362262         CDS       T05148                                 

Gene name
AURKC
Definition
(RefSeq) aurora kinase C
  KO
K11480  aurora kinase C [EC:2.7.11.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101362262 (AURKC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101362262 (AURKC)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101362262 (AURKC)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: AGC group
  AUR family [OT]
   101362262 (AURKC)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101362262 (AURKC)
  Sister chromatid separation proteins
   Aurora kinases
    101362262 (AURKC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 101362262
NCBI-ProteinID: XP_012421532
UniProt: A0A2U3ZRC2
Position
Unknown
AA seq 307 aa AA seqDB search
MKSGGVGPAGEGERTQDQRKAAAGHVELSVPPVRRLTIDDFEIGRPLGKGKFGNVYLARL
KESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAYLQHPNILRLYNYFHDARRVYLILEY
APRGELYKELQKSHTLDEQHTATIMEELADALTYCHEKKVIHRDIKPENLLLGFRGEVKI
ADFGWSVHTPSLRRKTMCGTLDYLPPEMIERRTYNEKVDLWCIGVLCYELLVGNPPFESP
SHNETYRRILKVDVRFPPSLPLGAQDLISKLLRYEPSERLPLAQILEHPWVRAHSQRVLP
PSVQMAS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgggcggtgttgggcccgcaggtgaaggggagaggacccaggaccagagaaaa
gccgcagcaggccacgtggagctcagcgtcccgcccgtgcggcgactcacaattgatgac
tttgaaatcgggcgtcctctgggcaagggaaaatttgggaatgtgtacctggctcggctc
aaggaaagccattttatcgtggccctgaaagtcctcttcaagtcccagatagaaaaggaa
ggactggagcaccaactgcgcagggaaattgaaatccaggcgtatctacaacaccccaat
atcctacgtctatacaactatttccatgacgcacgccgtgtgtacctgattctggaatat
gctccaaggggtgagctctacaaggagctgcaaaagagccatacattagatgaacagcac
acagccacgataatggaggaattggcagatgctctgacttactgccacgagaaaaaggtg
attcacagggatattaaaccagagaacctactgctggggttcaggggtgaggtgaagatt
gcagactttggctggtctgtgcacaccccatctctgaggagaaagacaatgtgtgggact
ctggactacttgcccccagaaatgattgaaaggagaacatacaatgagaaggttgatctg
tggtgcattggagtactgtgctatgagctgctggtgggaaatccaccctttgagagccct
tcccataatgagacctatagacgcatcctcaaggtagatgtaaggtttcccccatcatta
cctttgggggcccaggacttgatctccaagcttctcagatacgagccttcggagcggctg
cccttggcccagatcctggagcacccctgggtccgggcccactctcagagggtgttgcct
ccgtctgttcagatggcttcttga

DBGET integrated database retrieval system