KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362308
Entry
101362308         CDS       T05148                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oro03036]
    101362308 (ANKRD53)
Chromosome and associated proteins [BR:oro03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    101362308 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4 PHD
Other DBs
NCBI-GeneID: 101362308
NCBI-ProteinID: XP_012417200
UniProt: A0A2U3ZDY2
Position
Unknown
AA seq 509 aa
MQPAEKASYMVTWGEAASQQPRAKGPDPDSAFLLTCPLPTHANPDDEWDQSAIGSYYELF
AAALGNLEWLRFCLSRDRDKIPADDKGFTAIHFAAQSGKLTCLQVLVEEYKFPVDLPTNN
GQTPLHLVIHGDNKTMTLPCIHYLLKQGAALNTWFAHLSDGQMAILSALFPAGGALYSQT
CNGSTPLHLAACKGLLSCVKVLVQNGANVHARDAMGCKPIDYCKIWNHRDCARFLKDAMW
KRDKKDFACEMGKLKRLKDQLAFMEQDYLTEYQKEHQILREADFKKWLHRKQLLQGQSLI
RNAKQAPCAPPQAIAIPKTLKHQGPRKSFYPSPEARLRQTSAPKLQSLGTPTSIYMQPMV
RRPKSWNVSNNPARSPTTQIGYPQGIRLGVHPDPSPEHDFHSFLKVRSDRHGGAQLCTVA
GNRVAPAPQLPFKVVVQELYPSVRPHRMKVPQGFCPVSMRHVPRKWLLGDNFWTDTLAMN
LRETFDEAFLAAVQAHQGLPTLPSPKSPP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcagccggcggagaaagcctcctacatggtcacctggggtgaagcggcgtcccagcag
cccagggccaaaggcccagacccagactccgctttcttgctcacctgcccactcccgacc
cacgctaaccccgacgatgagtgggaccagagtgccattgggagctactacgagctgttc
gcggctgcactgggcaacctggaatggctgcgtttctgtctgagtcgggaccgtgacaaa
attccggcagatgacaagggcttcactgccatccactttgcagcccagagtggcaagctt
acgtgcctgcaggtcttggtagaagagtacaagtttcccgtggacctgcccaccaacaat
ggccagacacccctgcacctggtcatccacggggacaacaagaccatgaccctcccctgc
attcactatctacttaagcaaggggcggccctcaacacctggtttgcccacctctctgat
gggcaaatggccatcctttctgccctcttcccggccggcggggccctgtacagtcagaca
tgcaatggctccacacccctccacctggcagcttgcaagggcctgctgagctgcgtgaag
gtgctggtgcaaaatggcgccaatgtccacgcccgagatgccatgggctgcaagcccatc
gactactgcaaaatatggaaccaccgcgactgtgcccggttcttgaaggatgccatgtgg
aaacgggacaagaaggactttgcttgtgagatggggaaactgaagaggctcaaggaccag
ctggccttcatggaacaagactacctgaccgagtatcaaaaagagcaccaaattctgaga
gaagcggatttcaagaagtggctccatcgcaagcagctgctccaaggccaatccctgatc
cgcaatgccaagcaagcgccttgtgccccaccccaggcgatcgccatccccaagaccctc
aagcaccaggggcctcgaaagagcttctacccctccccagaggcacgcctgcggcagaca
tcagcgcccaagctgcagtccttggggacacccacatccatctacatgcagcccatggtc
aggcggcccaagtcgtggaatgttagcaacaatcctgccagatcacccaccacccagatc
ggctacccacagggcatccgcctaggtgtgcatccagaccccagtccagagcacgacttc
cacagcttccttaaggtgaggtctgaccggcacggcggtgcacagctgtgcacggtggcc
ggcaaccgggtggcacctgcgccccagctgcctttcaaggtggtagtccaagagctgtac
ccttcagtgcggccacacaggatgaaagtgccccagggcttttgccctgtcagcatgagg
cacgtgccccggaagtggctcttgggtgacaacttctggactgacactctggccatgaac
ctgcgtgagacatttgatgaagccttcctggcagctgtgcaagcccatcaagggctcccc
actctgccctcccccaaaagccccccataa

DBGET integrated database retrieval system