KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362322Help
Entry
101362322         CDS       T05148                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00564  Glycerophospholipid metabolism
oro00565  Ether lipid metabolism
oro00590  Arachidonic acid metabolism
oro00591  Linoleic acid metabolism
oro00592  alpha-Linolenic acid metabolism
oro01100  Metabolic pathways
oro04010  MAPK signaling pathway
oro04014  Ras signaling pathway
oro04072  Phospholipase D signaling pathway
oro04217  Necroptosis
oro04270  Vascular smooth muscle contraction
oro04370  VEGF signaling pathway
oro04611  Platelet activation
oro04664  Fc epsilon RI signaling pathway
oro04666  Fc gamma R-mediated phagocytosis
oro04724  Glutamatergic synapse
oro04726  Serotonergic synapse
oro04730  Long-term depression
oro04750  Inflammatory mediator regulation of TRP channels
oro04912  GnRH signaling pathway
oro04913  Ovarian steroidogenesis
oro04921  Oxytocin signaling pathway
oro05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101362322 (PLA2G4B)
   00565 Ether lipid metabolism
    101362322 (PLA2G4B)
   00590 Arachidonic acid metabolism
    101362322 (PLA2G4B)
   00591 Linoleic acid metabolism
    101362322 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    101362322 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101362322 (PLA2G4B)
   04010 MAPK signaling pathway
    101362322 (PLA2G4B)
   04370 VEGF signaling pathway
    101362322 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    101362322 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101362322 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101362322 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    101362322 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    101362322 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101362322 (PLA2G4B)
   04913 Ovarian steroidogenesis
    101362322 (PLA2G4B)
   04921 Oxytocin signaling pathway
    101362322 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101362322 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    101362322 (PLA2G4B)
   04726 Serotonergic synapse
    101362322 (PLA2G4B)
   04730 Long-term depression
    101362322 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101362322 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101362322 (PLA2G4B)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101362322 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 101362322
NCBI-ProteinID: XP_012417817
UniProt: A0A2U3ZFQ4
Position
Unknown
AA seq 782 aa AA seqDB search
MALAKVPGTCLLTIRVLQAHGLPSKDLVTPSDCYVSLWLPTASSHRLQTRTVKNSRNPVW
NQSFRFRIHSQLKNVLQLQVFDQDLLTSDDPMLSVLFDLGTLQAGDFRRESFSLNPQGEE
RLEVEFRLQRLTDCAEQLFSNGILVARELSCLHVRLEEAGDQKQSEGRVQLVVPGSCEGQ
HEASVGADPFCFHCPACWEQELGILLQDAPQEQLKVPLRALPSGQVVRLVFPTSQEPLMR
VELRKEEGPRELAVRLGCGPCAEEQAFLSRRKQVVARALKQALQLDDDLQEDEIPVVAVM
ATGGGIRAMVSLYGQLAGLRELGLLDCISYITGASGSTWALANLYEDPEWSQKDLAGPTA
TLKTQVTKNKLGMLAPSHLQRYWQELAERARQGHPTCFTDLWALISEALLHDEPHDHTLS
AQREALSHGQNPLPIYCALNTKEKNLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGRLTRRLPESRICFLEGIWSNLYAANLQDSLYWASEPGQFWDRWAQDRANLDKEQVPL
LKIEETPTGAGRIAEFFTDLLTRRPLAQATHNFLRGLHFHKDYFHHPYFSTWKATKLDGL
PNQLTPAEPHLCLLDVGYLINTSFPPLLRPTRDVDLILSLDYNLGGAFQQLQLLGQLCQA
QGIPFPPISPSPEEQRQPRECHLFLDPACPDAPAVLHFPLVDGSFREYEAPGILRPPEEK
AAGEVNLSSSDSPYHYSKLTYSPEDADKLLCLTHYNICNNRERLLEALRGALQRRRGRHQ
PQ
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcaaaggttcctgggacctgcctgctcaccattcgtgtcctgcaggcccat
ggcctgccctcgaaggacctagtgaccccctctgactgctatgtgagtctgtggctgccc
acagcctctagccacaggctccagacacgcacagtcaagaacagcagaaaccccgtctgg
aatcagagctttcgcttccgaatccacagccagctcaagaatgtcttgcagctgcaagtc
tttgaccaggatcttctgaccagcgatgaccccatgttgtcagtgctatttgacttgggg
actttgcaggctggggacttccgccgagagagcttctccctgaaccctcagggtgaggag
cggctagaagttgaatttcggctgcagagattgacagactgtgctgagcagctcttcagc
aatggcatcctggtggcccgggagctctcctgcttgcatgttcgactggaggaggcaggg
gaccagaagcagtcagagggcagagttcagcttgtggttcctgggtcctgtgagggtcaa
catgaggcctccgtgggtgctgaccccttctgcttccattgcccggcctgctgggagcag
gaactgggtattcttctgcaggatgcccctcaagagcaactgaaggtgcccctaagggcc
ttgccctctggccaagtggtgaggcttgtcttccctacgtcccaggaacccctgatgagg
gtggagctgagaaaagaagaaggaccgagggagctggcggtgcggctgggctgtggcccc
tgtgccgaggagcaggccttcctgagcaggaggaagcaggtggtggccagagccctgaag
caggccctgcagctggatgatgacctgcaggaggacgagatccccgtggtagctgttatg
gccaccggtggtgggatccgggcgatggtttccctctatgggcagctggctggactgagg
gagctgggtctcttggattgcatctcctacatcacaggggcctcgggctccacctgggct
ttggccaacctctacgaagacccagaatggtctcagaaggacctggcagggcccaccgcg
acactgaagacacaggtgaccaagaacaaattgggcatgctggcccccagccatctccag
cggtactggcaggagctggccgagcgtgcccgccagggccacccaacctgcttcaccgac
ctgtgggccctcatcagcgaggcactgctgcacgatgagccccatgaccacacactctca
gcccagcgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaggaaaagaacctgaccacctttgaatttggagagtggtgtgagttctccccttat
gaggttggctttcccaagtacggcgccttcatcccctctgagctctttggctccgagttc
ttcatggggcgcctgaccaggcggcttcctgagtcccgaatctgcttccttgaaggtatc
tggagcaacctgtacgccgccaacctccaggacagcttatactgggcctcagagcccggc
cagttctgggaccgctgggcacaggatcgggccaacctggacaaggagcaggtccctctt
ctgaagatagaagaaactcccacaggggctggcaggattgctgagtttttcactgacctt
ctgacacggcgcccactggcccaggccacccacaatttcctgcgaggcctccatttccac
aaggactatttccatcatccttacttttccacctggaaagccaccaaactggatgggctc
cccaaccagctgacacctgcagagccccacctttgtctgctggatgttggctaccttatc
aacaccagcttcccgcccctcctgcggcccacacgggatgtggacctcatcctgtcgctg
gattataacctcggaggagcctttcagcagctgcagctcctgggccagctgtgccaggcg
cagggcatccctttcccgcccatctcacccagccctgaggagcagcgccagcctcgcgag
tgccacttgtttctggacccggcctgccccgacgccccggctgtgctgcacttccctctg
gtggatggctccttccgcgaatacgaggcccctggcatcctgcgcccccctgaggagaag
gcggccggggaggtgaacctgtcttcctccgactccccctaccactactctaagctgacc
tacagcccggaggacgcagacaagctgctctgcctgacccattacaacatctgcaacaac
cgggagcggctgctggaggcgctgcggggcgccctgcagcggaggcgtgggcggcaccag
ccccagtga

DBGET integrated database retrieval system