KEGG   Odobenus rosmarus divergens (Pacific walrus): 101362499
Entry
101362499         CDS       T05148                                 

Gene name
ACY3
Definition
(RefSeq) LOW QUALITY PROTEIN: N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming)
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101362499 (ACY3)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     101362499 (ACY3)
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 101362499
NCBI-ProteinID: XP_012423127
UniProt: A0A2U3ZVW8
Position
Unknown
AA seq 430 aa
MAAQAQARDSVIQTWKKFCPAAYDPPLLHLEGWVHIAPGHSGTGCPGACPSTSRGLRSFL
FYNGVPTSLLELATRVPSGSGVNVRPRGWIRGGNRGVTQRWLQAPGELQRLSVCTMPVLA
KPAAQAARRHYKGRDLNLHQHLPHPECPRCWAALPKTEVRASDRPLQPPAGHILCPRCPF
FPFRFRKIQTDVTFSRKPVLTSGCARANLADPYQVTGAGEPNQLLGPKASGQXFNFVFDL
HNTTASTGTCLITEAAHNISVKHLGYHLQSPVLELGPQPQGVLRADLFTRIRTXVAKVLD
FIELFNQAESSFGTGAAFPALELEANRTVGSVDFPRTEAGDPAGTVHPQLPGRDFQLLSP
SMAIFQMFSDEDVLYEGESAVYPVFIXEATYCERGIASLQTKKLIFSVPALAPTLGPSPT
PGLPRLSPPT
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggctgcgcaggcccaggctagagacagtgtcatccagacatggaaaaaattttgtcct
gctgcttatgacccaccgctcctccacctagagggctgggtccacatcgctccgggccac
agcggtaccgggtgccctggggcctgtccctcgacttctcggggtctccgttcctttctc
ttctacaacggggttcccacttccctcttagaattggccaccagggtcccttcaggctca
ggggtcaacgtcaggcctcggggctggatccgcggtggtaacagaggtgtgacccagcgc
tggctgcaggccccgggggagctgcagagactcagcgtctgcaccatgcccgtgctggcc
aagccggcagcccaagcggcccgccgccactacaagggccgtgacctcaaccttcaccag
caccttcctcacccggagtgtcctcgctgctgggcggccctgcccaagactgaagtccgc
gcctcagaccggccccttcagccaccagcaggccacatcctctgcccgagatgcccattc
ttccctttccggttcagaaaaatccagactgatgtcaccttttccaggaagcccgttctg
acctcaggctgtgccagggccaacctggctgatccataccaggtgacaggggctggagag
ccgaaccagctgctggggcccaaggcttcaggccagnccttcaactttgtctttgacctg
cacaacaccacggccagcacgggcacctgtcttatcacggaagctgctcacaacatctct
gtcaagcacctgggctaccacctacagtccccagtcctggagctgggaccccagcctcag
ggcgtgctgcgggcagacctattcaccaggataaggaccnctgtggccaaagtcctggac
ttcatcgaactcttcaaccaggctgagagctcctttggcacaggcgcggcctttcctgct
ttggagctggaagccaatagaaccgtgggcagcgtggacttcccacgtacggaggctggg
gacccggcaggcaccgtgcaccctcagctgccaggtagagacttccagctactgtcgccc
agtatggccatcttccagatgttcagtgatgaggatgtgctctatgagggggagtccgct
gtgtaccccgtgttcatcnacgaggccacctactgtgagaggggcattgcctccctccag
actaaaaagctcatattctctgtgcctgcccttgcccccaccctaggtccctcacccacg
ccaggcctgcccaggctcagccctcccacctga

DBGET integrated database retrieval system