KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363059Help
Entry
101363059         CDS       T05148                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X1
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00071  Fatty acid degradation
oro01212  Fatty acid metabolism
oro03320  PPAR signaling pathway
oro04152  AMPK signaling pathway
oro04714  Thermogenesis
oro04920  Adipocytokine signaling pathway
oro04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101363059 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101363059 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101363059 (CPT1C)
   04920 Adipocytokine signaling pathway
    101363059 (CPT1C)
   03320 PPAR signaling pathway
    101363059 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    101363059 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oro03029]
    101363059 (CPT1C)
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     101363059 (CPT1C)
Mitochondrial biogenesis [BR:oro03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101363059 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 101363059
NCBI-ProteinID: XP_004409952
UniProt: A0A2U3WLW1
Position
Unknown
AA seq 803 aa AA seqDB search
MAEAHQAVGFRPSTTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHRLRGVLAAALFASCLWGTLIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRKTMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPILSDEDFDWTSVLAQEFLRLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRHSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLNRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGIPKDHIRHLRDSRHVAVFHRGRFFRVGTYSQSGLLSPRALEQ
QFQRILDDPSPACPQEEHLAALTAAPRDVWAQVRSSLKIQAKDALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYARALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPEPSLPQPQRLHWDLPEKIRLSISLALRGAKTLSGN
IDCHVFPFSHFGKSFIKRCHLSSDSFIQVALQLAHFRDRGEFCLTYESTMTRLFLEGRTE
TVRSCTREACNFVRAMEDKEKTEPQRRALFRLAVEKHQALLKAAMSGQGVDRHLFALYIV
SEFLHLRSPFLDQVHSEQWPLATSQIPVQQIHLFDVHNYPDYVSSGGGFGPADDHGYGVS
YIFMGDDTITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQDGQRPKPRCRGLQEEHT
GHRGGSLPCHRTGSRAPTKSTNF
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgacgacctcggacggggccgaa
gtggagctcagtgcccctgtgttgcaggagatctacctctccggactgcgctcctggaaa
aggcacctctcccgtttctggaatgactttctcactggtgtgttccccgccagcccgctc
agctggctcttcctcttcagtgcgatccagctcgcctggttcctccagctggatccttct
ctaggactgatggaaaagatcaaagagttgctgccagactggggtggacagcaccacagg
cttcggggagtcctggccgcagcactgtttgcttcgtgtctgtggggaaccctgatcttc
acgcttcacgtggccctgaggctgcttctgtcctaccatggctggctccttgaaccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctccggccgc
aaaacaatgctcttcagttaccagcgctccctgccacgccagcccgtgccctcggtgcag
gacaccgtgcgcaagtacctggaatctgtccggcccatcctctccgacgaggacttcgac
tggacgtcagtcctcgcgcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaatttgtg
tacctgcgctcccggcactcgctgatggtgaacagcaactattacatgatggacttcctg
tacgtcactcccacaccagtgcaggccgctcgtgctgggaacgcagtccatgccctcctc
ctataccgccaccgcctgaaccgccaggagatcctgcctacgctgctgatgggaatgcgg
cccttgtgctctgcccagtatgagaagatattcaataccacgcgcattcctggcatccca
aaagaccacatccgccatctccgggacagccgacacgtggccgtctttcaccgaggccga
ttcttccgcgtggggacctactcccaaagcggcctgctctccccgcgggccctggagcag
cagttccagcgaatcctggacgacccctcccccgcctgcccccaggaggagcatctggct
gccctgaccgccgcacccagggatgtgtgggcccaggtgcggagttccctgaagatccag
gccaaggatgccttggaggccgtggaaggagctgctttctttgtatcactggactcggag
cctgcagggctcaccagggaagaccccgcagcttcactggatgcctatgcccgtgcccta
ctggctggcaggggccatgaccgctggtttgacaaatccttcactctaattgtcttctcc
aacgggaagctgggcctcagcgtggagcactcatgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagagtgttttcagctgggctactcggcagatggccac
tgcaaggggcatcctgagccctcgctgccccagccgcagcggctacactgggaccttcca
gaaaagatccgtctgtccatctctctagccctgaggggagccaagaccttgtctggaaac
attgactgccacgtcttccctttctcccactttggcaagagcttcatcaaacgctgccat
ctctcttcagacagcttcatccaggtggccttgcagctggcccacttccgggacaggggt
gaattctgcctgacttatgagtcgaccatgactcgcttgttcctggaaggccggacagag
acggtgcggtcttgcacgagggaggcctgcaacttcgtgagagccatggaggacaaagag
aaaacagaaccccagcgccgtgctctgttccgcctggcagtggaaaagcaccaggctctg
ctgaaggcagcgatgagcggacagggagtcgaccgccacctctttgcgctctacatcgtg
tccgaatttctccacttacggtcgccctttctggaccaggttcactcggagcagtggcct
ctggccaccagccagatccctgttcagcaaatccacctatttgatgtccacaattaccct
gactatgtttcctctggtggtggatttgggcctgccgatgaccatggttatggcgtttcg
tacatcttcatgggggatgacaccatcaccttccacatctccagcaaaaaatctagcaca
aaaacggactcccaccgactggggcagcacattgaggacgcactgttggatgtggcctcc
ctcttccaggacgggcagcgtcctaagcccaggtgcagagggttacaggaggagcacacg
gggcacaggggtggctctctcccctgccacaggacgggctccagggcacccacaaaatcc
accaacttttga

DBGET integrated database retrieval system