KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363316Help
Entry
101363316         CDS       T05148                                 

Gene name
GALC
Definition
(RefSeq) galactocerebrosidase isoform X1
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00600  Sphingolipid metabolism
oro01100  Metabolic pathways
oro04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    101363316 (GALC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101363316 (GALC)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     101363316 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M Glyco_hydro_30
Motif
Other DBs
NCBI-GeneID: 101363316
NCBI-ProteinID: XP_004398148
UniProt: A0A2U3VS77
Position
Unknown
AA seq 685 aa AA seqDB search
MAERLLQASRQRRMKAMTAAAGSAGRAAVPLLLCALLVPGGAYVVDDSDGLGREFDGIGA
ISGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNIILMGLPWSFPGWLGKGFNWPYVNLQLTAYYVMTWIV
GAKHYHDLDIDYIGIWNERSYDINYIKVLRRMLNYQGLDRVKIIASDNLWEPISASMLLD
SELLEVIDVIGAHYPGTHIVKDAKLTKKKLWSSEDFSTVNSDVGAGCLGRILNQNYINGY
MTATIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPIWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSHQFATFVLKGSFSEI
PELQVWYTKLGKPSTRFLFKQLDSLWLLDSSGTFSLELQEDELFTLTTLTTGGKGSYPLP
PKSQPFPRIYKDDFDVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHRFTLRQVLNQRPIT
WAADAYNTISIIGDYKWSNLTVTCDVYIETPEKGGVFIAGRVNKGGILIRGARGVFFWIF
ANGTYRVTGDLAGWIIYALGHVDVTAKTWYTLRLIVKGRFSSGMLNGRAVWTNIPVSFPK
NGWAAIGTYSFEFAQFDNFHVEATS
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgcctactccaggcttcccggcaacgccgaatgaaagccatgacggccgcc
gcaggttcggcgggccgcgccgcggtgcccctactgctgtgcgcgctgctggtacccggc
ggcgcgtacgtggtggacgactccgacgggctgggccgggagttcgatggcatcggcgcg
atcagcggcggcggggcaacctcccgacttctagtaaattatccagagccctatcgttct
caaatattggattatctctttaagccaaacttcggtgcctctttgcatattctaaaagtc
gaaataggtggtgatgggcagacaacagatggtaccgaaccctcccacatgcactatgca
ttagatgagaattatttccgaggatatgagtggtggttaatgaaggaagctaagaagcgg
aaccctaatattatactcatgggcttgccgtggtcgttccctggatggctgggaaaaggt
ttcaactggccttatgtgaatcttcagctgactgcctattatgtcatgacctggattgtg
ggtgccaagcattatcatgatttggatattgattatattgggatttggaacgagaggtca
tatgacatcaattatatcaaggtgttaagaagaatgctgaactatcaaggtctcgatcga
gtgaaaatcatagcgagtgacaatctctgggagcccatttctgcttctatgttgctcgac
tctgagctcttggaggtgattgatgttataggagctcattatcctgggacccacatagta
aaggatgcgaagctgactaagaagaagctttggtcttctgaagattttagcactgtaaat
agtgatgtgggtgcaggctgcttgggccgcatattgaatcagaattatatcaatggctac
atgactgccacaattgcttggaatttggtggctagttactatgaacagttgccttacgga
cggtgtggattgatgactgcccaggagccatggagtgggcactatgtagtagagtctcct
atctgggtatcagctcataccactcagtttactcaaccaggttggtattacctgaagaca
gttggtcacttagagaaaggaggaagctacgtggctctgactgatggcctaggtaacctc
accatcatcattgaaactatgagccataaacattctaagtgtatacggccgtttctgcct
tacttcaatgtgtcacatcagtttgctacctttgttcttaaaggttcttttagtgaaata
ccagagctacaggtctggtatacgaagcttggaaaaccatctacgagatttctttttaaa
caactggattctctatggcttcttgacagcagtggcaccttctccctggagctgcaggag
gacgagctcttcacgctcaccactctcacaaccgggggcaagggcagctacccactgcct
ccgaagtcccagcccttcccacgaatttataaagatgatttcgatgttgattacccattt
tttagtgaagctccgaattttgctgatcagactggcgtctttgaatactttacgaacatt
gaagaccctggagagcatcgcttcacactacgccaagttcttaatcagcggcccattact
tgggctgctgatgcatacaacaccatcagtattataggagattacaaatggtccaatctg
actgtaacgtgtgatgtttacatagagactcctgagaagggaggcgtgttcattgccgga
agagtaaacaaaggtggtatcttgattagaggcgccagaggagttttcttctggattttt
gcaaatggaacctacagagttacaggtgatctagctggatggatcatatatgctttagga
catgttgacgttacagcaaaaacttggtatacactcagattaattgttaagggccggttc
tcctctggcatgctgaatggcagggctgtctggacgaacatccctgtgagtttcccgaag
aatggctgggccgccattggaacttactcctttgaatttgcacagtttgacaactttcat
gtggaagccacaagctaa

DBGET integrated database retrieval system