KEGG   Odobenus rosmarus divergens (Pacific walrus): 101363916Help
Entry
101363916         CDS       T05148                                 

Gene name
FDPS
Definition
(RefSeq) farnesyl pyrophosphate synthase isoform X1
  KO
K00787  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00900  Terpenoid backbone biosynthesis
oro01100  Metabolic pathways
oro05164  Influenza A
oro05166  Human T-cell leukemia virus 1 infection
Module
oro_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101363916 (FDPS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101363916 (FDPS)
   05164 Influenza A
    101363916 (FDPS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:oro01006]
    101363916 (FDPS)
Enzymes [BR:oro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     101363916 (FDPS)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     101363916 (FDPS)
Prenyltransferases [BR:oro01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   101363916 (FDPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 101363916
NCBI-ProteinID: XP_004402999
UniProt: A0A2U3W4H0
Position
Unknown
AA seq 420 aa AA seqDB search
MPLSRWLRSVGVFLLPAPCWAPRERWLGPLRRPFLVHGCPVLGAWHSARCWCQAWTEEPR
ALYSSLRMNGDQKLDPYAQAKQDFIQHFSQIVKVLTEDGVGHPETGDAIARLKEVLEYNA
VGGKYQRGLTVLIAFQELVEPKKQDADSLRRALTVGWCVELLQAFFLVSDDIMDSSLTRR
GQICWYQKPGVGLDAVNDALLLEACVYRLLKLCCREQPYYLSLIELFLQSSYQTEIGQTL
DLITAPQGNVDLGRFTEKRYKSIVKYKTAFYSFYLPVAAAMYMAGLDGEREHANAKKILL
EMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLRRASPEQRQLLQENYGQK
EAEKVARVKALYEELNLPAVFTQYEEDSYGHLMGLIEQYASPLPPAVFLALARKIYKRKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtcccgctggctgagatctgtgggggtcttcttgctgccagccccctgctgg
gcgccccgggagaggtggttgggtcccctacggcggcccttcctggtgcacgggtgccca
gtcctgggggcctggcacagtgcccgctgctggtgccaagcgtggacagaggagcctcga
gcactttactcctccctcagaatgaatggagaccagaaattggacccttatgcccaagca
aagcaggatttcatccagcatttctcccagattgtcaaggtgctgaccgaggatggcgtg
ggccaccctgagacgggagacgccattgcccggcttaaggaggtcttggagtacaatgcg
gttggaggcaagtaccagcggggtttgactgtgctgatagcatttcaggagctggtagag
ccgaagaagcaggatgccgatagtctccggcgggccctgactgtgggctggtgtgtggaa
ctgctgcaagctttcttcctggtgtccgacgacatcatggactcgtccctcacccgacgg
gggcagatctgctggtatcagaagccaggcgtaggtttggatgccgtcaacgacgctttg
cttctggaagcctgcgtctaccgcctgctgaagctctgctgtcgggagcagccctattac
ctgagcctgattgagcttttcctgcagagttcctatcagaccgagatcggacagaccctg
gacctcatcacagccccacagggcaatgtggatcttggcaggttcactgaaaagaggtac
aaatctattgtcaagtacaagaccgctttctactcattctatcttcctgtggcggctgcc
atgtacatggcgggcctcgatggggagagagagcatgccaatgccaagaagatcctgctg
gagatgggggagttctttcagattcaggacgattacctcgacctctttggggaccccagt
gtgacaggcaagattggcacagacatccaggacaacaagtgcagctggctggtggttcag
tgtctgcggcgggcctctccggaacagcgtcagctcctccaggagaattacgggcagaag
gaggcggagaaggtggcccgggtgaaggcgctgtacgaggagctgaacctgcccgccgtg
ttcacgcagtacgaggaagacagctatggccaccttatgggcctcatcgagcagtacgcc
tcgcccctgccccccgccgtcttcctggcgctggcacgcaagatctacaagaggaaaaag
tga

DBGET integrated database retrieval system