KEGG   Odobenus rosmarus divergens (Pacific walrus): 101365634Help
Entry
101365634         CDS       T05148                                 

Gene name
QDPR
Definition
(RefSeq) dihydropteridine reductase isoform X1
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00790  Folate biosynthesis
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101365634 (QDPR)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     101365634 (QDPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase PRMT5
Motif
Other DBs
NCBI-GeneID: 101365634
NCBI-ProteinID: XP_004410344
UniProt: A0A2U3WMT9
Position
Unknown
AA seq 242 aa AA seqDB search
MAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVVVKMTDSFTE
QADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSMWTSTISSHLA
TKHLKDGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPSGSAAITVLP
VTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGKTELTPA
YF
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcgggcgaggcgcgccgggtgctggtgtacggcggcaggggcgcgctg
ggctcgcgatgcgtgcaggcgttccgggcccgcaactggtgggtcgccagcatcgatgtg
gtggagaacgaagaggccagtgcaagtgttgtagttaaaatgacagactcatttacggag
caggctgaccaggtgactgctgaggtcggaaagctcttaggtgaagagaaggtggacgcg
atcctctgtgtggctggaggctgggctgggggcaatgccaaatccaagtctctctttaaa
aactgtgacctgatgtggaagcaaagcatgtggacgtcgaccatctccagccacctggct
accaagcacctcaaggacggaggcctcctgaccttggctggtgccaaggccgcccttgac
gggactcctgggatgatcggctacggcatggccaagggcgctgttcatcagctctgccag
agcctcgctgggaagaacagcggcatgccttccggctctgcggccatcactgtgctcccg
gtgaccctggataccccgatgaacaggaaatccatgcctgaggccgacttcagttcctgg
acgcccttggagttcctggtcgaaaccttccacgactggatcacagggaaaaaccgaccg
agctcagggagcctgatccaggtggtaaccacggagggaaagacggagcttaccccagcg
tatttttaa

DBGET integrated database retrieval system