KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367643Help
Entry
101367643         CDS       T05148                                 

Definition
(RefSeq) arylamine N-acetyltransferase 1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00232  Caffeine metabolism
oro00983  Drug metabolism - other enzymes
oro01100  Metabolic pathways
oro05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    101367643
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101367643
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101367643
Enzymes [BR:oro01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     101367643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 101367643
NCBI-ProteinID: XP_004417387
UniProt: A0A2U3X4X6
Position
Unknown
AA seq 290 aa AA seqDB search
MDIEAYFERIGYKNPRKKLDLETLTDILQHQIRTIPFENLDIHCGEAMELGLEPIFDQVV
RKNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPASKYSKAMIHLLLMVTTDGRNYI
VDAGFGRSYQMWQPLELISGKDQPQVPCIFHLTEDKGIWYLDQIRRDQYIPNQDFLNSDL
LEKNKYRKIYSFTLEPRTIEDFESVNTYLQMSPTSVFTNKSFCSLQTSEGVHCLVGCTLT
YRKFNFKDNMDLIEFKILNEEEVEKKLKNIFNISLEKKLVPKHGDQFFTI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgaagcatattttgaaagaattggttataagaaccctaggaagaaattggac
ttggaaacattaactgacattcttcagcaccaaatccgaaccattccttttgaaaacctt
gacatccattgtggggaagccatggaattgggcttggagcccatttttgatcaagttgta
aggaagaaccgtggtgggtggtgtctccaggtcaatcatcttctgtactgggctctgacc
acaatcggttttgagaccacaatgttaggagggtatgtttacagtactccagccagcaaa
tatagcaaggctatgattcaccttctgctgatggtgactactgatggcaggaattacata
gtagatgctgggtttggacgctcttaccagatgtggcagcctctggagttaatttctggg
aaggatcagcctcaggtgccttgcatcttccacttgacagaagacaaaggaatctggtac
ttggaccaaatcagaagagaccagtacattccaaaccaagactttcttaattctgatctc
ctagaaaagaacaaataccgaaaaatatactcctttactcttgaacctcgaacaattgaa
gattttgagtctgtgaatacataccttcaaatgtctccaacatctgtgtttacaaacaag
tcattctgttccttgcagacttctgaaggggttcactgtttagtgggctgcacccttacc
tataggaaattcaattttaaggacaatatggatttgatagagtttaaaatactgaatgag
gaagaagtagaaaaaaagctgaaaaatatatttaatatttccttggagaaaaagcttgtg
cccaaacatggtgatcaattttttaccatttag

DBGET integrated database retrieval system