KEGG   Odobenus rosmarus divergens (Pacific walrus): 101367977Help
Entry
101367977         CDS       T05148                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00010  Glycolysis / Gluconeogenesis
oro00562  Inositol phosphate metabolism
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101367977 (MINPP1)
   00562 Inositol phosphate metabolism
    101367977 (MINPP1)
Enzymes [BR:oro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101367977 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101367977 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708 SID
Motif
Other DBs
NCBI-GeneID: 101367977
NCBI-ProteinID: XP_004409755
UniProt: A0A2U3WLE1
Position
Unknown
AA seq 495 aa AA seqDB search
MLGGPRRIMLGGPERLVKVSVTPVAALAVALLSSLSRCSLLEPEDPAVSALSPYFGTKTR
YEDANPGLLPDPEAPRRDPELLEDTCTPVQLVALIRHGTRYPTAKQIRKLRQLHGLLQAR
RPGDGRAGPAGGRDLGAALADWPLGYADWMDGQLVEKGRQDMRQLALRLASLFPALFSVE
NYGRLQLVTSSKHRCVDSGAAFLQGLWQYYHPGLPPPDVADMECGPPRINDKLMRFFDHC
EKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNNLNADLIQVAFFTCSFDL
AIKGVKSPWCDVFDIDDAKVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAIE
QKQRSQPISSPVILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQLHRKFRSGHIVPYA
SNLIFVLYHCKNAKTPKEEFRVQMLLNEKVLPLAHSQETASLYEDLKDHYKDILQNCQTS
EECQLPKVNNTSDEL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcggcccgcgccgcatcatgctcggcggccccgagcgccttgtcaaggtctcc
gtgacaccggtcgcggccctggctgtggcgctgctctcgtcgctctcgcgctgctccctc
ctggagccggaagaccccgcggtctcggcgctcagcccctacttcggcaccaagacccgc
tacgaggatgccaaccccgggctgctgccggaccccgaggcgccgcggagggaccctgag
ctgctggaggacacctgcaccccggtgcagctggtcgccctcatccgccacggcacccgc
taccctacggccaagcagatccgcaaactgcggcagctgcacggcctgctgcaggcccgc
cggcccggcgacgggcgcgctggcccggcaggaggccgtgacctgggcgccgcgctggcc
gactggccgctgggatacgcggactggatggacgggcagctggtggagaaggggcggcag
gacatgcgacagctggcgctgcgcctggcctccctcttcccggctctcttcagcgtcgag
aactacggccgcctgcagctggtcaccagctccaaacaccgctgcgtggacagcggcgcc
gccttcctgcaggggctgtggcagtactaccacccggggctgccgccgcccgacgtcgca
gacatggagtgtggacctccaagaattaatgataaactaatgaggttctttgatcattgt
gagaagtttttaactgaagtggaaaagaatgctacggctctttatcatgtagaagccttc
aaaactggaccagaaatgcagaacattttaaaaaaggttgcagctactttgcaagtgcca
gtcaacaatttaaatgcggatttaattcaggtagctttttttacctgttcatttgacctg
gcaattaaaggtgttaaatctccttggtgtgatgtttttgacatagatgacgcaaaggta
ttagaatatttaaatgatctgaaacagtattggaaaagagggtatggatatactattaat
agtcgatccagctgcaccctgtttcaggatatcttccagcacttggacaaagcaattgaa
cagaaacaaaggtctcagccaatttcctctccagtcatccttcagtttggtcacgcagag
acccttcttccactgctctctctcatgggctacttcaaagataaggagcccctaacagct
tataattacaaggaacaattgcatcgcaaattccgaagtggccacattgtgccctacgcc
tcgaacctaatattcgtgctttaccactgtaaaaatgctaagactcccaaggaggaattc
cgagtgcagatgctattgaatgagaaggtgttaccattggctcactcacaagaaactgcc
tccttgtacgaggatctaaaggaccactacaaggacatccttcagaactgtcagaccagt
gaagagtgccagttaccaaaggtgaacaatacgtctgacgagctctga

DBGET integrated database retrieval system