KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368249Help
Entry
101368249         CDS       T05148                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4 isoform X1
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04020  Calcium signaling pathway
oro04024  cAMP signaling pathway
oro04080  Neuroactive ligand-receptor interaction
oro04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101368249 (HTR4)
   04024 cAMP signaling pathway
    101368249 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101368249 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    101368249 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oro04030]
    101368249 (HTR4)
G protein-coupled receptors [BR:oro04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    101368249 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 101368249
NCBI-ProteinID: XP_004402841
UniProt: A0A2U3W427
Position
Unknown
AA seq 388 aa AA seqDB search
MDELDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFVDLLVSVLVMPFGAIELVQDIWIYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSEGRP
QPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESHCHPPATSSLVATQPSDP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacttgatgctaatgtgagttccaaggagggttttgggtcagtggagaaggtc
gtgctgctcacgtttctctcggcggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgcagggacaggcagctcaggaagataaaaaccaattacttcattgta
tctctcgcctttgtggatcttctggtttcggtgctggtgatgccctttggtgccatcgag
ctggttcaagacatctggatttatggggagatgttttgccttgtccggacatctctagac
gtcctgctcacgacggcatcgatttttcacctgtgctgcatttctctggataggtattat
gccatctgctgtcagcctctggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccatgtttatctcttttctccctataatgcaaggc
tggaataatattggcataattgatttgatagaaaaaaggaagttcaaccagaactctaac
tctacgtactgtatcttcatggtcaacaagccctatgccatcacctgctctgtggtggcc
ttctacatcccgtttctcctcatggtgctggcctattaccgcatctacgtcacagcgaag
gagcatgcccaccagatccagatgttacaacgggcaggagcctcctcagaaggcaggccc
cagccagccgaccagcacagcactcatcgcatgaggacagagaccaaagcagctaagacc
ttgtgcatcatcatgggttgcttctgcctctgctgggctccattctttgtcaccaatatc
gtggatccattcatagactacaccgttcctggacaggtgtggaccgctttcctctggctt
ggttacatcaactctgggttgaacccctttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccctccattctg
ggccagactgtcccctgttcaaccacaaccattaatggatccacacatgtgctaagggat
gcggtggagtgtggtggccaatgggagagtcactgccaccctccagcaacttcttctttg
gtggctactcagcccagcgacccttag

DBGET integrated database retrieval system