KEGG   Odobenus rosmarus divergens (Pacific walrus): 101368585Help
Entry
101368585         CDS       T05148                                 

Gene name
HLCS
Definition
(RefSeq) biotin--protein ligase
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00780  Biotin metabolism
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    101368585 (HLCS)
Enzymes [BR:oro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     101368585 (HLCS)
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     101368585 (HLCS)
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     101368585 (HLCS)
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     101368585 (HLCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_N
Motif
Other DBs
NCBI-GeneID: 101368585
NCBI-ProteinID: XP_004414201
UniProt: A0A2U3WXK5
Position
Unknown
AA seq 1132 aa AA seqDB search
MVPAQPAPLRRRQRHGRASNRSGEGAHLPRPRGFGARLQTSRDPLDPPSLRCRSAGSRDA
PTALREPGRVETRLRFQAVEGRGEESEKTARRPPSRGLGKNTTPRGGARDLPPVSPEPRL
ESAWMSLEPPMPGPEDTSPGCRARGGARAQLPPSPAQGQGEGMLVYQLPRRQTWAWTRRS
ARRRHIPAVRTPSRGPKPRGARPFRRRWGTQRGGAGRPAAAGGGRGRSPGRGPPRGTAGD
PPGPAEGGRGRFRKGREETSGPGSATALALLPAGPPPALSACQCAGAARRPQPGQPHSRV
PPAGGRRPRRTCVPGGSGSGNEQDRPTRGRKARVGERGGRPGRALGGQVEESREKGAQVE
PEVPASVASGGYSSQDLGLCSGSGAPPRGFPTWPFPPFVPDAPAATCSVLGTPSGAFRQR
SATPWAAARSPAGAGGPGSGSRYVRRGWRGSVRPARAASPLWHGLFRPAGGRAWGGAGRE
GRAGGASVRGSRPAAGRPVMLITLCYLYLWARWGRQPAALVRATVQRLRASRCSFTFCGA
AARPQGARVCLSRGGRVFCVGESQSIDDLNKWALFLVSPFILEAEHIAFVTESIWVQGES
LQRPASSSETIVKWSDCCLPLACRPGDPYQLIAEASVDDFSKLGVAFMEDRLQMADGLVP
QKIVSVHLQDCTLKALEDQASNKQAQTLQQNPEPSAESKPEPDIMECIGRDDPKVLGAQP
TLGTGDAFGSEPAGEGDRGVGSVEHCPLHLSSCHECLELENSTIESVKFASAENIPDLPY
DHSGSLEDVADDIRLERERRRVNITGKAPNILFYVGSAPQKSLGRFQEVRSVLADCVDTD
SYTLYHLSRESALRDPWSDNCLLLVIATQEAIPEDLSQKFMAYLSQGGKVLGLCSSFTFA
SFQVTSKSVLKETVQNLVFSKADHTQVKLSVLSSGYVFEESPGERRSLGKLQGHLENGDK
DRLIVQVPFGTRGGEAVLCQVHLELPPSSSVVQAQEDFDLLKSSNIRRYEVLREILTTLG
LNCDIKHVPALTPLYLLPATEEIWDPLMRWLGKHVDPEGVIKSSKLSLKFLSSYTSEIEI
NPSALPVVTDVEAFSSENFNLDIYRQNLQTERLGKVILFAEVTPTTMNLLDG
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atggtgcccgcgcagccagcgcctctccggcggcgccagcgacacggccgcgcctctaac
cgctcgggcgagggcgctcacctaccacggccgcggggttttggggcgcggctacagacg
tctcgggaccctctggacccgccgtccctgcggtgccggagcgcgggctcccgggacgcc
ccgacggcgctgcgcgaaccgggtagggtggaaacgcggctgcgcttccaggcggtggaa
ggccgcggagaggagagcgagaagacagcacgccgcccaccgtctcgaggcttgggaaag
aacacgactccccgtgggggtgcgagggatttgcctccggttagcccggagccgcgatta
gaaagcgcctggatgagcctggagccgccgatgcccggccccgaggacacttccccaggc
tgcagagctcgagggggcgcgcgagcgcagctgccaccgtcgccagcgcagggtcagggg
gaaggaatgctggtttatcagctgccccggcgacagacctgggcctggacccggagaagc
gccaggcgccgccacatccccgccgttcgcacgccctcccgcggccccaagccccgcggc
gcgcgtcccttccggaggcggtgggggacgcagcggggcggggcgggacggccggccgcc
gccgggggagggcggggtcgcagtccgggccgcgggccgccgcgggggacggcgggagac
cctcccgggcccgccgagggggggagggggcgcttccggaagggccgcgaggaaacctcg
ggacccggcagcgccaccgcactcgcgctcctccccgcgggtcccccgccggctctgtcc
gcttgtcagtgcgcaggcgcggcacgccgcccgcagcctggccaaccacattctcgggtc
ccgcccgccggcgggcgccgtcccagacgcacgtgtgtgccaggtggaagcggtagcggg
aacgagcaggatcggcccacgcgcggccggaaggcacgagtaggagaacgcgggggcagg
ccaggccgtgctctgggcggccaagtggaggagagccgggagaagggtgcccaggttgag
ccagaagtccctgccagtgtggccagcggtggctacagcagtcaggatttggggttgtgc
agcggcagtggggccccaccgaggggtttccctacttggcctttcccaccgttcgttccc
gacgcccccgctgccacctgctctgtcctgggcacaccttccggtgcatttcggcagcgg
tcggccaccccgtgggccgcggcgcggagcccggctggggcgggggggccgggctccggc
agcaggtacgtgcggcgcggatggcggggctctgtccgacccgcccgcgcggcctcaccc
ctatggcacggcctcttccggcccgcgggagggcgggcgtggggcggggccgggcgggag
gggagagccggtggtgcgagcgtccggggctcgcgccccgccgccggccggccggtcatg
ctcatcacgctgtgctacctctacctgtgggcgcgctgggggcgccaaccggccgcgctc
gtgcgcgcgacggtgcagcggctgcgcgcctcgcgctgctccttcaccttctgcggcgcg
gccgcgcggccccagggcgcccgcgtgtgcttgagccgcggcggccgcgtcttctgcgtc
ggcgagagccagtccattgatgacttgaacaaatgggccctgtttcttgtctctcctttt
atacttgaagcagaacacatagcatttgtgacagagagcatttgggtgcaaggtgagagt
ttacagagaccggcttcctcttcagaaaccattgtgaagtggtccgactgctgtttgcca
ttagcttgcagacctggggatccttatcaattaatcgctgaagcaagcgtggatgacttc
agtaagctgggggtggcgttcatggaagatagactccagatggctgatggattggtacct
caaaagattgtttcagtgcacttgcaggactgtactctgaaggcacttgaggatcaagcc
tcaaacaagcaagcccagaccctacagcagaatcctgaaccttccgctgagagtaagcct
gagccggacattatggagtgcattggtagagatgatcccaaggttcttggtgcacaaccc
acactggggacaggggatgcctttggcagtgagcctgccggggagggtgacagaggagta
ggctctgtcgagcactgtcccctccatctgtctagttgccatgagtgtctggagcttgag
aacagtaccattgaatctgtcaagtttgcatctgcagagaacattccagatcttccctat
gatcacagtggcagtttggaggatgttgctgatgatatccgcttggagagagaacggcgg
agagtcaacatcacgggaaaggcccccaacatcctcttctacgtgggctctgccccccag
aaatccctgggcaggttccaggaggtccggtccgttctggcagactgtgtggacaccgac
agctatacgctctaccacctgtcaagggaaagtgctctcagagacccgtggtcagacaac
tgtctgttgttggtcattgccacccaggaggctattcctgaagacctttcccagaagttc
atggcctacctttctcagggagggaaagtgttaggcctgtgttcgtccttcacatttgct
agcttccaggtgacgagcaagagtgtgctcaaggaaaccgtccagaacttggttttctcc
aaggctgaccacacccaggtgaagctcagcgtcctgagcagtggctacgtttttgaggaa
agccctggggagcgccgcagcctgggcaagctgcagggtcacctggagaatggggacaag
gacaggctgatagtgcaggtgccttttggaactcgtggaggagaagctgttctttgccag
gtgcacttagaactacctcccagttcttcagtggtgcaagcccaagaagattttgatctg
ctcaaatcaagcaatattagaagatatgaagtccttagggagatcctgacaacgctcggc
ctaaactgtgacatcaaacacgttcctgccttaacccctctttacttactgcctgcgact
gaggaaatctgggatcctcttatgcggtggctggggaagcatgtggatcctgaaggagtc
ataaaatccagcaagctctcccttaagtttctttcatcctacacgtctgaaatagaaatc
aatccatctgccctacctgtggtgactgacgtggaggccttctcttcagaaaattttaac
ttagacatctaccgacagaatctgcagacagagcgacttggaaaagtaattctgtttgcc
gaagtgacgcctaccacgatgaaccttctggacgggtaa

DBGET integrated database retrieval system