KEGG   Odobenus rosmarus divergens (Pacific walrus): 101371712Help
Entry
101371712         CDS       T05148                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04966  Collecting duct acid secretion
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    101371712 (SLC4A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oro02000]
    101371712 (SLC4A1)
   04147 Exosome [BR:oro04147]
    101371712 (SLC4A1)
   04090 CD molecules [BR:oro04090]
    101371712 (SLC4A1)
Transporters [BR:oro02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   101371712 (SLC4A1)
Exosome [BR:oro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101371712 (SLC4A1)
CD molecules [BR:oro04090]
 Proteins
  101371712 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 101371712
NCBI-ProteinID: XP_004407320
UniProt: A0A2U3WFA2
Position
Unknown
AA seq 921 aa AA seqDB search
MEGWQEDHEEGLEDALEQEEYEDPDVPVLQVEEPVADHAEPTATDYDTSPDPDATSRAGT
HAVYVELQELVMDEKNQELRWMEAAHWVRLEENLREDGVWSRPHLSYLNFWSLLELQKAF
AKGTVLLDLPETSLAGVANQLLDGFIYEEQIRPEARDLLLRVLLLQHSHAGDLEALGGVK
PTVLTRSGNPSQPLLPQHPSLETELFCEQGTEGHSPSGILEKIPPDSEATLVLVGRAEFL
ERPVLGFVRLQAPTELEAVGLPVLVRFLFVLLGPEAPNINYTQLGRAAATLMSERVFRTD
AYLAQSKAELVRNLEGFLDCSLVLPPCEAPSEQALLSLVPVQKELLRRRYLLSPAKPEPH
FYKGLDLYGGPGAPAGPDDPLQRTGLLFGGLVRDIRRRYPHYLSDITDAFSPQVLAAVIF
IYFAALSPAITFGGLLGEKTQNQMGVSELLISTAVQGIVFSLLGAQPLLVVGFSGPLLVF
EEAFFSFCANYSLEYIVGRVWIGFWLVLFVVLIVAFEGSFLVRFISRYTQEIFSFLISLI
FIYETFVKLIKIFQDHPLQKHYDHNVTMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKF
KNSSYFPGVLRRVIGDFGVPISILIMVMVDFFIEDTYTQKLSVPKGLSVSNSSARGWVIH
PLGLSSHFPIWMMFASALPAMLVFILIFLESQITTLIISKPERKMVKGSGFHLDLLLVIG
MGGVAALFGMPWLSATTVRSVTHANALTVMGKASAPGAAAQIQEVKEQRISGLLVAVLVG
LSILMGPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPSKYHPDVPYVKRVTTW
RMHLFTIIQIICLAGLWTVKTFPTTSLTLPFVLILTVPLRRLLLPLIFRTLELQCLDADD
AKPTFDEEEGRDEYNEVTMPV
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcaggaggatcatgaagaggggctggaggacgctctggaacaggaggag
tatgaagacccagatgtccccgtgcttcaggtggaggagccagtagctgatcacgctgag
ccaacagccacagactacgacaccagcccagacccagacgccacatcacgcgcaggcacc
cacgcggtgtacgtggagctgcaggagttggtgatggatgagaagaaccaggagttgcga
tggatggaggcagcgcactgggtgcggctggaggagaacctgagggaggatggggtctgg
agccgcccgcacctgtcctacctcaacttctggagcctcctggagctgcagaaagccttt
gccaagggtactgtcctcctggatctgccagagacctccctggcgggggtggccaaccag
ctgctggacgggtttatctacgaggagcagatccggcctgaggcccgagacctgctgctc
cgggtcctgctgctccagcacagccatgccggagacctggaggccctggggggtgtgaag
cccacggttctgacccgttccgggaacccctcacagcctctgctcccccagcacccctcg
ttagagacggagctcttctgtgaacagggcacagaagggcattccccatctggaattcta
gagaagattcccccagattcggaggccaccctggtgctcgtgggccgagcagagttcctg
gagcgcccggtgctgggcttcgtgcggctgcaggcgcccacggagctggaggctgtgggg
ctcccagtgcttgtacgcttcctctttgtgctgctgggacccgaggcccccaacatcaac
tacacccagcttggtcgggcggcggccaccctcatgtccgagagggtgttccgcacagat
gcctacctggctcagagcaaggcggagctggtccgcaacctggagggcttcctggactgc
agcctggtgctgcctccctgtgaagccccctccgagcaggccctgctcagtctggtgccc
gtgcagaaggagctgctgcggagacgctacctgctcagccccgccaagcccgagccccac
ttctacaagggtctggatttgtatgggggcccaggggcccctgctgggccagacgaccct
ctgcagcggacaggcctgctctttgggggcctggtgcgtgacatccggcgccgctacccc
cactacttgagtgacatcacagacgcgttcagcccccaggtcctggctgctgtcatcttc
atctactttgctgccttgtcacctgccatcaccttcggcggcctcttgggagaaaaaacc
cagaaccagatgggggtgtcggagctgctcatctccactgcagtgcagggcattgtcttc
tccctgctcggggctcagcccctacttgtggttggcttctcaggacccctgctcgtgttt
gaagaagcctttttctcgttctgcgctaactacagcctggagtacatcgtgggtcgcgtg
tggatcggcttctggctggtcctgttcgtggtgctcatagtggccttcgagggcagtttc
ctggtccgcttcatctcccgctacacccaagagatcttctccttcctgatctccctcatc
ttcatctatgagaccttcgtcaagctgatcaagatcttccaagaccatccacttcagaag
cattatgaccacaatgtgacaatggtgcccaaacctcagggtcccctgcccaacacagcc
ctcctctcccttgtgctcatggctggcaccttcttcttcgccatgatgctgcgaaagttc
aagaacagctcctacttccctggcgtgctgcgacgggtcattggggacttcggggtcccc
atctccattctgatcatggtcatggtggatttcttcatcgaggacacctacacccagaaa
ctcagtgtgcctaaaggcctctcggtgtccaactcctcagcccggggctgggtcatccac
ccactgggcttgagttcgcatttccccatctggatgatgtttgcctccgccctgcctgcc
atgctggtcttcattctcatcttccttgagtctcagatcaccacgctgattatcagcaaa
ccagagcgcaagatggtcaagggctctggcttccacctggacctgctgctggtcataggc
atgggcggtgtggctgccctctttgggatgccctggctcagtgccaccactgttcgttcc
gtcacccacgccaacgcgctcactgtcatgggcaaggccagcgccccaggggctgcagcc
cagattcaggaggtcaaggagcagcggatcagtgggctcctggtcgctgtgcttgtgggc
ctgtccatcctcatggggcccatcctgtcccgcatccccctggctgtgctgtttggcatc
ttcctctacatgggggtcacgtccctcagcggcatccagctctttgaccgcatcttgctt
ctgttcaagccgtccaagtaccacccagatgtgccctatgtcaagcgggtgaccacctgg
cgcatgcacttgttcacgatcatccagatcatctgcctggcagggttgtggacggtgaag
acctttcccaccacctcgctgaccctgcccttcgtgctcattctcacggtgcctctgcgc
cgccttctgctgccgctcatcttcaggacgctggagctccagtgtctggatgctgacgat
gccaagccgaccttcgatgaagaggaaggtcgggatgaatacaacgaggtgaccatgccc
gtgtga

DBGET integrated database retrieval system