KEGG   Odobenus rosmarus divergens (Pacific walrus): 101372122Help
Entry
101372122         CDS       T05148                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase isoform X1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00480  Glutathione metabolism
oro00590  Arachidonic acid metabolism
oro01100  Metabolic pathways
oro04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101372122 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101372122 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    101372122 (GPX5)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     101372122 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 101372122
NCBI-ProteinID: XP_004411352
UniProt: A0A2U3WQ70
Position
Unknown
AA seq 223 aa AA seqDB search
MVMTAQLRASYLVPLVLVSFAQTNAKPEKMKMDCYKDVKGTIYEYGALSLNEEEHIPFKR
YAGKHVLFVNVATYCGLTAQYPELNALQEELKPLGLVVLGFPCNQFGKQEPGENSEILLG
LKYVRPGRGYVPNFQLFEKGDVNGEKEQKVFTFLKLSCPHPSEVLGSFRHISWDPVKVHD
IRWNFEKFLVGPDGVPVMRWFHRTPISTVKSDILEYLKQSKSK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgactgcacagttaagggcctcttaccttgttcctcttgtgctagtcagcttt
gcacagacaaatgccaagcctgagaagatgaagatggattgctacaaagatgtgaaaggc
accatctatgagtatggagccctcagcctcaatgaagaggagcacattccgttcaagcgg
tacgcgggcaagcacgtcctctttgtcaacgtggctacctactgtggcctgacagctcag
taccccgaactgaatgcacttcaggaggagctgaagcccttgggcctggtcgtgttgggc
tttccctgcaaccagttcggaaagcaggaaccaggagagaactcagagattcttctgggg
ctgaagtacgtccgtccagggagaggatacgtacccaatttccagctctttgagaaaggg
gatgtgaacggcgagaaggaacagaaggtcttcaccttcttgaagctctcctgccctcac
ccctctgaggttctgggctcattcagacacatatcctgggatcctgtaaaggtccacgac
atccgctggaactttgagaagttcttggtggggcctgatggagtccctgtcatgcgctgg
ttccaccggactcccatcagcacggtcaagtcagacatcctggagtacctgaaacagtcc
aaaagtaaatag

DBGET integrated database retrieval system