KEGG   Odobenus rosmarus divergens (Pacific walrus): 101373645Help
Entry
101373645         CDS       T05148                                 

Gene name
METTL3
Definition
(RefSeq) N6-adenosine-methyltransferase 70 kDa subunit
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oro03019]
    101373645 (METTL3)
Enzymes [BR:oro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     101373645 (METTL3)
Messenger RNA biogenesis [BR:oro03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     101373645 (METTL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MT-A70 DUF445
Motif
Other DBs
NCBI-GeneID: 101373645
NCBI-ProteinID: XP_004402174
UniProt: A0A2U3W2D6
Position
Unknown
AA seq 580 aa AA seqDB search
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGG
PKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSIRLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVTGTITGQKRRA
EQDSTTVAAFASSLASGLASTASEAAKEPTKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacacgtggagttctatccaggcccacaaaaagcagttggactcgctgcgagag
aggctgcagcggaggcggaagcaggactcggggcacttggatctacgaaatccagaggca
gcactgtctcccaccttccgcagtgacagcccagtgcctactgcacccacttctggtggc
cctaagcccagcacagcttcagcagttcctgaactagctacagaccccgagttagagaag
aaattgctacaccatctctctgatctggccttaacattgcccactgatgctgtgtccatc
cgtcttgccatctccacgccagatgcccctgccactcaagatggggtagaaagcctccta
cagaagtttgcagctcaggagttgattgaggtaaaacgaggtctcttacaagatgacgca
catcccactcttgtgacctatgctgatcattccaagctctctgctatgatgggtgctgtg
gcagaaaagaagggccctggggaggtaacagggactatcacagggcagaagcggcgtgca
gagcaggactcaaccacagtagctgcctttgctagctctttggcctctggcctggcctct
acagcatcagaagcagccaaggagccaaccaagaaatcaaggaaacatgctgcctcagat
gttgatctggagatagagagccttctgaaccaacagtctactaaggaacaacagagtaag
aaggtcagtcaggagatcctagagctattaaatacaacaacagccaaggagcagtccatt
gttgaaaagtttcgctcacgaggtcgggcccaagtacaagagttctgtgactatggaacc
aaggaggagtgcatgaaagccagtgatgctgaccggccctgccgcaagctgcacttcaga
cgaatcatcaataaacacactgatgagtcattaggtgactgctctttccttaacacatgt
ttccacatggatacctgcaaatatgttcactatgaaattgatgcttgcatggattctgag
gctcctgggagcaaagaccatacacctagccaggagcttgctcttacacagagtgttgga
ggtgactccagtgcagatcgactcttccctcctcagtggatctgttgtgatatccgctac
ctggacgtcagtatcttgggcaagtttgcagttgtgatggctgacccaccctgggatatt
cacatggagctgccctatgggaccctgacagatgatgagatgcgcaggctcaacatacca
gtactgcaggatgatggctttctcttcctctgggtcacaggcagggccatggagctgggc
agagaatgtctgaacctctggggttatgaacgggtagatgaaattatctgggtgaagaca
aatcaactgcagcgcattattcggacaggccgtacaggtcactggttgaaccacgggaag
gaacactgcttggttggtgtcaaaggaaatccccaaggcttcaaccagggtctggattgc
gatgtgatcgtagctgaggttcgttctaccagtcataaaccagatgaaatctatggcatg
attgagagactatcccctggcactcgcaagattgagttatttggacgaccacacaatgtg
cagcccaactggatcacccttggaaaccaactggatggaatccacctactagacccagat
gtggttgcccggttcaagcaaaggtatccagatggtatcatctctaaacctaaaaatctg
tag

DBGET integrated database retrieval system