KEGG   Odobenus rosmarus divergens (Pacific walrus): 101374313
Entry
101374313         CDS       T05148                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00230  Purine metabolism
oro01100  Metabolic pathways
oro01522  Endocrine resistance
oro04015  Rap1 signaling pathway
oro04020  Calcium signaling pathway
oro04022  cGMP-PKG signaling pathway
oro04024  cAMP signaling pathway
oro04062  Chemokine signaling pathway
oro04072  Phospholipase D signaling pathway
oro04114  Oocyte meiosis
oro04211  Longevity regulating pathway
oro04213  Longevity regulating pathway - multiple species
oro04261  Adrenergic signaling in cardiomyocytes
oro04270  Vascular smooth muscle contraction
oro04371  Apelin signaling pathway
oro04540  Gap junction
oro04611  Platelet activation
oro04713  Circadian entrainment
oro04714  Thermogenesis
oro04723  Retrograde endocannabinoid signaling
oro04724  Glutamatergic synapse
oro04725  Cholinergic synapse
oro04727  GABAergic synapse
oro04742  Taste transduction
oro04750  Inflammatory mediator regulation of TRP channels
oro04911  Insulin secretion
oro04912  GnRH signaling pathway
oro04913  Ovarian steroidogenesis
oro04914  Progesterone-mediated oocyte maturation
oro04915  Estrogen signaling pathway
oro04916  Melanogenesis
oro04918  Thyroid hormone synthesis
oro04921  Oxytocin signaling pathway
oro04923  Regulation of lipolysis in adipocytes
oro04925  Aldosterone synthesis and secretion
oro04926  Relaxin signaling pathway
oro04927  Cortisol synthesis and secretion
oro04928  Parathyroid hormone synthesis, secretion and action
oro04934  Cushing syndrome
oro04935  Growth hormone synthesis, secretion and action
oro04970  Salivary secretion
oro04971  Gastric acid secretion
oro04972  Pancreatic secretion
oro04976  Bile secretion
oro05032  Morphine addiction
oro05163  Human cytomegalovirus infection
oro05166  Human T-cell leukemia virus 1 infection
oro05200  Pathways in cancer
oro05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101374313 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101374313 (ADCY4)
   04371 Apelin signaling pathway
    101374313 (ADCY4)
   04020 Calcium signaling pathway
    101374313 (ADCY4)
   04072 Phospholipase D signaling pathway
    101374313 (ADCY4)
   04024 cAMP signaling pathway
    101374313 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101374313 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101374313 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101374313 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101374313 (ADCY4)
   04062 Chemokine signaling pathway
    101374313 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101374313 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101374313 (ADCY4)
   04912 GnRH signaling pathway
    101374313 (ADCY4)
   04913 Ovarian steroidogenesis
    101374313 (ADCY4)
   04915 Estrogen signaling pathway
    101374313 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101374313 (ADCY4)
   04921 Oxytocin signaling pathway
    101374313 (ADCY4)
   04926 Relaxin signaling pathway
    101374313 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    101374313 (ADCY4)
   04918 Thyroid hormone synthesis
    101374313 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101374313 (ADCY4)
   04916 Melanogenesis
    101374313 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101374313 (ADCY4)
   04927 Cortisol synthesis and secretion
    101374313 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101374313 (ADCY4)
   04270 Vascular smooth muscle contraction
    101374313 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101374313 (ADCY4)
   04971 Gastric acid secretion
    101374313 (ADCY4)
   04972 Pancreatic secretion
    101374313 (ADCY4)
   04976 Bile secretion
    101374313 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101374313 (ADCY4)
   04727 GABAergic synapse
    101374313 (ADCY4)
   04725 Cholinergic synapse
    101374313 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101374313 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101374313 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101374313 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101374313 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101374313 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101374313 (ADCY4)
   04714 Thermogenesis
    101374313 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101374313 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101374313 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    101374313 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101374313 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101374313 (ADCY4)
   05163 Human cytomegalovirus infection
    101374313 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101374313 (ADCY4)
Enzymes [BR:oro01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101374313 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 101374313
NCBI-ProteinID: XP_012418446
UniProt: A0A2U3ZII4
Position
Unknown
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLCALLAMLAVAYASGRDLASDRG
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSVLVWAALLGLGHSFQFTGGLVSAWDQV
SFFLFIIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGAYHKALMERALRATFREALRSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDASMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTR
YLESWGAAKPFAHLSHLESPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDEDLDTGDAK
FFQVIEQLNSQKQWKQSKDLNPLTLYFREKELEKEYRLSALPAFKYYAACTFLVFLSNFI
IQMLVTNRPPALAIAYSVTFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSSLVATRP
GLRVALGTATILLVFVMAITSLFFLPAASDCPSRAANVSSVASNLSWELPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGTSCSLFLHSHAWLSDCVLARLYPAPSDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWQKKLRQEQEETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDTQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNDFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETARVLQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLS
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgcttctgctgctggtgatcgtgctctgcgca
cttctggcgatgctggctgtcgcctacgccagcggcagggatctagcttcagaccggggc
ttcctgaccactgtgctgtgcgcactgggtggcttctcgctgctcctgggtctggcttcc
cgcgagcaacgactgcagcgctggacacgccccctgtcggtcctggtgtgggccgcacta
ctcgggctaggccacagcttccagttcactgggggcctggtgagcgcctgggatcaggtg
tcctttttcctcttcatcatattcaccgtgtatgccatgttgcccttgggcatgcgggat
gctgctgccgcgggccttgcctcatcactctcccacctgctggtccttgggctgtacctg
gggcctcagccggattctcggccggcgctgctgccgcagctggcagcaaacgccgtgttg
ttcctgtgtgggaacgtggccggggcgtaccacaaggcactgatggagcgcgcgctgcgc
gccacattccgggaggctcttcgttccctgcactcgcgccgccggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacttggcccgagagatgaag
gcagagatcatggcacggctgcaggctggacaggggtcacggccagagagcaccaacaac
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagtgagtgctcccctaaggagttggtgctcatgctcaacgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggcttccgctctccctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactccgggcagccaccggc
gtagacatcaacatgcgtgtgggtgtgcattcgggcagtgtgctctgtggagtcatcggc
ctacagaagtggcagtatgatgtctggtcccatgatgtcacgctggccaaccacatggag
gcgggcggcgtgccaggacgagtacatattacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcatccatggaacaccgggacccataccttcgggagctaggg
gagcccacctacctagtcatcgatccccgggctgaggaggaggatgagaagggcactgcg
ggagggctgctgtcctctctcgagggtcccaagatgcggccgtcactgctgatgacccgc
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacctagagagccct
gtgtccacctccacccctctcccggagaaggccctggcctccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgaggaccttgacactggggacgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggactta
aacccattgacactgtacttcagagagaaggagctggagaaagagtatcgactctctgcc
ctccctgccttcaaatactatgcagcctgcaccttcctggtcttcctctccaatttcatc
atccagatgctggtgaccaacaggcccccagctctggccatcgcctatagcgtcaccttc
ctcctcttcttcctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttg
aaaggccccaagatgctgcactggctgcccacactgtctagcctggtggccacacggccc
ggcctgcgagttgccctgggcacggccaccatcctcctcgtttttgtcatggctattacc
agcctgttcttcttaccggcagcatcagactgcccttcccgggctgccaatgtgtcctcc
gtggcttccaacctctcctgggagctccctgggtccctgcctctcatcagcgtcccatac
tctatgcactgctgcgtgctggggttcctgtcctgctccctctttctgcacatgagcttc
gagctgaagttgctgttgctcctgctatggctggggacctcctgctccctcttcctgcac
tcccatgcctggctgtccgactgcgtcctcgcccgcctctatccggctccctcggactcc
aggccaggggtgctgaaggagcccaaactgatgggagctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcggcagaatgagtattactgccgcctggacttcctgtgg
cagaagaagctgcggcaggagcaggaggagacagagacaatggagaacctgacacggcta
ctgctggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggacctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagttcca
gactttaaggagttttactctgaatccaacatcaaccacgagggtctagagtgtctgcgg
ctgctcaatgagatcattgctgactttgacgagctgctctcaaagcccaagtttagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tccggacaggacacacagcaggatgctgagcgaagctgcagccacctcggcaccatggtg
gagtttgcagtggcccttggatcgaagctggatgtcatcaataagcactccttcaacgac
ttccgcctgcgtgtggggttgaaccatggacctgtagtagccggagtgattggggcccag
aagcctcagtacgacatctggggcaacacggtgaatgtggccagccgcatggagagtaca
ggagtcctgggcaagatccaagtgactgaagagacagcccgggtgctgcagtccttaggc
tatacctgctacagccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggccctccttcggccaccctaagctga

DBGET integrated database retrieval system