KEGG   Odobenus rosmarus divergens (Pacific walrus): 101375448Help
Entry
101375448         CDS       T05148                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04020  Calcium signaling pathway
oro04713  Circadian entrainment
oro04925  Aldosterone synthesis and secretion
oro04927  Cortisol synthesis and secretion
oro04929  GnRH secretion
oro04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101375448 (CACNA1I)
   04020 Calcium signaling pathway
    101375448 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101375448 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    101375448 (CACNA1I)
   04927 Cortisol synthesis and secretion
    101375448 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101375448 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101375448 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101375448 (CACNA1I)
Ion channels [BR:oro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101375448 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 101375448
NCBI-ProteinID: XP_004397524
UniProt: A0A2U3VQZ4
Position
Unknown
AA seq 2143 aa AA seqDB search
MAETESSPPPSAPAAAPAAEPGVTEQLGPQSPPPSPPGLEEPLDGADPEVPHPDLAPVAF
FCLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFD
DFIFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRT
VRVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRC
FLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDD
VYDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGW
VEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRY
LSSSTVASYAEPGDCYEEIFQYVCHILRKARRRALGLYQALQSRRQAPAPGAPTPAKPGP
HAKEPRRYKLCPQHSPLDPTPHTLVQPISAMLASDPASCPRCQHGASRRPSGPGSTDSGQ
EGSGSGGSGGGSEEADGDGARSSDGGASSGLGKEDEEEQADGATRLCRDVWRETRAKLRG
IVDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMLLKLAAFG
LFDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVL
MKTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVF
QILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSY
SDEDQSSSNMEEFDKLQEGLDGGGDPKLCPIPMTPNGHLDPNLPLGGHLGPTGAAAPAPR
LSLQPDPVLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLK
HKPLSAEHESLLSAERGGGTRACEGARDEGPPRAAPLHAPHAHHALHGPHPAHRHRHHRR
TLSLDTRDSMDLAELVPAGGAHPRAAWRAVGPAPGHEDCNGRMPSIAKDVFTKMDDHRDR
GEDEEEIDYTLCFRVRKMIDVYKPNWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYV
VLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAY
LRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLV
VETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYR
WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVPNHNPWMLLYFISFL
LIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYCP
TRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEAV
LKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIARV
LKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEGM
SRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFVL
TAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPSPRPPASSPGAPGRG
PGGAGGGGDAEGRLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHYSSP
AGCEKCHHDKQEVQLAETEAFSLNSDKSSSILLGDDLSLEDPTACPLGRKDSRGEPDTPE
PMHTGEVGECFFPLSNTATSSDPETVLWESEAVPSNPVRSWLKQESSRAAPPRPFSPDAS
SPLLPMPAEFFHPAVSASQKGQEKGPGTGTLPKIALQGSWASLRSPSVNCSLLRQATGSD
TSLEASRSSSAGSLQTTLEDSLTLSDSPRRALGPPAPALGPRAGLSPAARRRLSLRGRGL
FSLRGLRAHQRSHSSGGSTSPGCTHHDSMDPSDEEGAGGRGGAGGGGAGSEHSETLSSLS
LTARSPSWAAERSKDAGGAPSAPEPQPAPGELQPGDAASKRKR
NT seq 6432 nt NT seq  +upstreamnt  +downstreamnt
atggctgagactgagagctccccaccgccctccgcccctgccgctgccccagcagctgaa
cctggagtcacggagcagctggggccccagagcccccctccctcccctccaggcctggag
gagcccctggatggagccgatcctgaagtccctcacccggacctggcccctgttgccttc
ttctgtctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaaccca
tggtttgaatgtgtcagcatgttggtgatcctgctgaactgcgtgacacttggcatgtac
cagccctgcgacgacatggactgcctgtctgaccgctgcaagatcctgcaggtctttgat
gacttcatcttcgtcttcttcgccatggagatggtgctcaagatggtggccctgggcatt
tttggcaagaagtgctaccttggggacacatggaaccgactggatttcttcatcgtcatg
gcagggatggtcgagtactccctggaccttcagaacatcaacctgtcggccatccgcacc
gtgcgtgtcctgaggcctctcaaagccatcaaccgtgtgcccagtatgcggatcctggtg
aacctgctcctggacacgctgcccatgctggggaatgtcctcctgctctgcttctttgtc
ttcttcatctttggcatcattggtgtacagctctgggcgggcctgctgcgtaaccgctgc
ttcctggaggagaacttcaccatacaaggggatgtggccctgcccccctactaccagcca
gaggaggacgacgagatgcctttcatctgctccctttcgggggacaatggcatcatgggc
tgccacgagatccccccactcaaggagcagggccgtgagtgctgcctgtccaaggatgat
gtgtacgacttcggggcagggcgccaggacctcaatgccagcgggctctgtgtcaactgg
aaccgctactacaacgtgtgccgcacaggcagtgccaacccccacaagggtgccatcaat
tttgacaacatcggctacgcatggatcgtcatcttccaggtgattactctggaaggctgg
gtggaaatcatgtactatgtgatggatgctcattccttctacaacttcatctattttatt
ctgcttatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacc
cagttctcggagaccaagcagcgggagcaccggctgatgctggaacagcggcagcgctac
ctgtcctccagcacggtggctagctacgcggagcccggcgactgttacgaggagatcttc
cagtacgtctgccacatcctgcgcaaggccaggcgccgggccctgggcctctaccaggcc
ctgcagagccggcgccaggcccccgccccaggggcgccgacccccgccaagcctgggccc
cacgccaaggagccgaggcgctacaagctgtgccctcaacacagtcccctggacccgacg
ccccacacgctggtgcagcccatctccgccatgctggcctccgacccggccagctgcccc
cgctgccagcatggggcgagccggcggccctcgggcccgggcagcaccgactcgggccag
gagggctcgggctctggtggctcaggtggtggctcggaggaggccgatggggacggagcc
cggagcagcgacggtggggcctcgtcagggctcgggaaggaggatgaggaggagcaggca
gacggggccacccggctgtgcagggatgtgtggcgggagactcgagccaagctccgaggc
attgtggacagcaagtacttcaaccggggcatcatgatggccatcctggtcaacaccgtc
agcatgggcatcgagcaccacgagcagcccgaggagctgaccaacatcctggagatctgc
aacgtggtcttcaccagcatgtttgccctggagatgctcctgaagctggctgcctttggg
ctctttgactacctgcgcaacccttacaacatctttgacagcatcattgttatcatcagc
atctgggagattgtggggcaggcggacggcggcctgtcggtgttgcggaccttccggctg
ttgcgggtgctgaagctggtgcgcttcatgcccgcgctgcggcgccagttggtggtgctc
atgaagaccatggacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatc
ttcagcatcctcgggatgcacatctttggctgcaaattcagcctccgcacagacacggga
gacaccgtccccgacaggaagaactttgactccctgctctgggccattgtcacagtgttc
cagatcctcacccaggaggactggaacgttgtcctctacaatggcatggcctccacctcc
ccctgggcctccctctactttgtcgccctcatgaccttcggcaactatgtgctcttcaac
ctcctggtggccatcctggtggagggcttccaggcagagggtgacgccaatcgctcctac
tcggacgaggaccagagctcatccaacatggaggagtttgacaagctacaggagggcctg
gatggcggtggagatcccaagctctgcccaatccccatgacccccaatgggcacctggac
cccaatctcccgctgggtggacatctgggccccaccggggctgcagcacctgccccccgc
ctctcgctgcagccggaccctgtcttggtggccctgggctctcgcaagagcagtgtcatg
tcactgggcaggatgagctatgaccaacgctccctgtccagctcccggagctcctactac
ggaccgtggggccgcagcggggcctgggccagccgccgctccagctggaacagcctgaag
cacaagccgctgtcggccgagcacgagtccctgctctcggcggagcgtggcggcggcacc
cgggcctgcgagggcgccagggacgaggggcccccgcgggccgcgccgctgcacgctccg
cacgcccaccacgcgctccacggtccccacccggcgcaccggcaccgccaccaccgccgg
acgctgtccctcgacaccagagactcgatggacctggccgagctggtgcctgcggggggc
gcccacccccgagcggcctggcgggcggtgggcccggcccccgggcacgaagactgcaat
ggcaggatgcccagcatcgccaaggatgtctttaccaagatggacgaccaccgggatcgc
ggggaggacgaggaggagatcgactacaccctgtgcttccgggtccgcaagatgatcgac
gtctataagcctaactggtgcgaggtccgcgaggactggtctgtctacctcttctccccc
gagaacaggttccgagtcctgtgtcagaccatcattgcccacaagctcttcgactatgtc
gtcctggccttcatctttctcaactgcatcaccatcgccctggagaggcctcagatcgag
gctggcagcaccgaacgtatcttccttacggtgtcgaactacatcttcacagccatcttt
gtaggcgagatgaccctgaaggtggtctcgctgggcctgtacttcggtgagcaggcctac
ctgcgcagtagctggaacgtgctggacggctttctcgtcttcgtgtccatcatcgacatc
gtggtttccgtggcctcagccgggggagccaagatcctaggggtccttcgggtcttgcgg
ctcctgcgcaccctacgccccctgcgtgtcatcagccgagcgcctggtctgaagctggta
gtggagacactcatctcttccctcaagcctatcggcaacatcgtcctcatctgctgtgcc
ttcttcatcatcttcggcatcctgggggtgcagctcttcaagggcaagttctaccactgt
ctgggtgtggacacccgcaacatcaccaaccgctctgactgcgtggccgccaactaccgc
tgggtccaccacaagtacaactttgacaacctgggccaggccctgatgtccctctttgtc
ctggcctctaaggacggctgggtgaacatcatgtacaatggactggacgctgtcgctgtg
gaccaacagcccgtgcccaaccacaacccctggatgctgctctacttcatctccttcctg
ctcatcgtcagcttcttcgtgctcaacatgtttgtgggcgtcgtggtggagaacttccac
aagtgccggcagcaccaggaggccgaggaggctcggcggcgagaggagaagcgactgagg
cgtctggagaagaagcgccggaaggcccagcggctgccctactatgccacctattgtccc
acccggctgctcatccattccatgtgtaccagccactacctggacatcttcatcaccttc
atcatctgcctcaatgtggtcaccatgtccctggagcattacaatcagcccacgtccctg
gagacagccctcaagtactgcaactacatgttcaccactgtgtttgtgctggaggctgtg
ctgaagctggtagcgtttgggctgaggcgcttcttcaaggatcggtggaaccagctggac
ctggccattgtgctgctgtcggtcatgggcatcacgctggaggagattgagatcaacgca
gcactgcccatcaaccccaccatcatccgcatcatgcgggttttgcgcatcgcccgggtg
ctgaagctgttgaaaatggccacggggatgcgggccctgctggacacggtggtgcaagct
ctgccccaggtgggcaacctgggtcttctcttcatgctgctcttctttatctacgccgcc
ctgggcgtggagctgtttggcaagctggtctgcaatgatgagaacccatgtgagggcatg
agccggcatgccacttttgagaatttcggcatggccttcctcacgctcttccaggtctcc
accggtgacaactggaatgggatcatgaaggacacgttgcgggactgcacccacgatgag
cgcagctgcctgagcagcctgcagtttgtgtcgccgctgtacttcgtcagcttcgtgctc
acggcccagttcgtgctcatcaacgtggtggtggccgtgctcatgaagcacctggacgac
agcaacaaggaggcccaggaggacgccgagatggacgccgagctggagctcgagatggcc
cacggtctgggtcccagcccgcggccgcccgccagctccccgggggcacctggccggggc
ccgggcggggcgggcggcgggggcgacgccgagggccgcctgtgccggcgctgctactct
ccggcccaggagaacctgtggctggacagcgtctctttaatcatcaaggactccttggag
ggggagctgaccatcatcgacaacctgtctggctccatcttccatcactactcctcgccc
gccggctgtgagaagtgtcaccacgacaagcaagaggtgcagctggccgagacggaggcc
ttctccctgaactcagacaagtcctcctccatcctgctgggtgatgacctgagtcttgag
gaccccacagcctgcccactcggccgcaaagacagcaggggtgagccagacacacctgag
cccatgcacacaggagaggtgggcgaatgcttcttccctttgtccaacacggccacctca
tcggatcctgagactgtcctgtgggagagtgaggcggtcccgtccaaccccgtccggtcc
tggctgaaacaggagagcagccgagctgcacccccaaggcccttctccccggatgcctcc
agcccactcctgcccatgcctgcggagttcttccatcctgccgtgtctgccagccagaaa
gggcaggagaagggccctggcactgggaccctccccaagatcgccctgcagggctcctgg
gcatccctgcggtcgccgagtgtcaactgcagcctcctccggcaggccacaggcagcgac
acgtcgctggaggccagccgcagcagctcggcgggcagcctgcagaccacgctggaggac
agcctgaccctgagcgacagtccccggcgcgccctggggccccccgcccccgccctgggc
ccccgggccggcctgtcgcctgcagcccgccgccgcctcagcctgcggggccggggcctg
ttcagcctgcgcggactgcgggcgcaccagcgcagccacagcagcgggggctccaccagc
ccgggctgcacccaccacgactccatggacccctcggacgaggagggcgcgggcggccgg
ggcggcgcgggcggcgggggcgcgggcagcgagcactcggagacgctcagcagcctgtcg
ctcacggcccggagcccctcctgggccgcggagcgcagcaaggacgcgggcggcgccccc
tcggcgcccgagccgcagccggccccgggagagctgcagccgggggacgcagcgagcaag
aggaagagatga

DBGET integrated database retrieval system