KEGG   Odobenus rosmarus divergens (Pacific walrus): 101376355Help
Entry
101376355         CDS       T05148                                 

Gene name
PNCK
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type 1B
  KO
K08795  pregnancy upregulated non-ubiquitously expressed CaM kinase [EC:2.7.11.17]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oro01001]
    101376355 (PNCK)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101376355 (PNCK)
Protein kinases [BR:oro01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101376355 (PNCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 101376355
NCBI-ProteinID: XP_004409220
UniProt: A0A2U3WK31
Position
Unknown
AA seq 343 aa AA seqDB search
MLLLKKQTEDISSVYEIREKLGSGAFSEVVLAQERGSSHLVALKCIPKKALRGKEALVEN
EIAVLRRVNHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQV
LGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVA
PELLEQKPYGKAVDVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDIS
ESAKDFIRHLLERDPQKRFTCQQALQHLWISGDAAFDKDILGSVSEQIQKNFARTHWKRA
FNATSFLRHIRKLGQSPEGEEASERRMARHSHPGLQSGQPPKW
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctcaagaaacagacggaagacatcagcagcgtctatgagatccgggagaag
ctcggctcgggcgccttctctgaggtggtgctggcccaggagcggggctcctcacacctt
gtcgccctcaagtgcatccccaagaaggcccttcgaggcaaggaggccctggtggagaac
gagatcgcagtgctccgcagggtcaaccaccccaacatcgtggctctggaggacgtccat
gagagcccttcccacctctacctggccatggagctggtgacagggggcgagctgttcgac
cgcatcatggagcgtggctcctacacagagaaggatgccagccacctagtgggccaggtc
ctcggtgctgtctcctacctgcacagcttgggcatcgtgcaccgagacctcaagcctgaa
aacctcctctatgccacgccctttgaggactccaaaatcatggtctccgactttggcctc
tccaaaatccaggctggcaacatgctaggcaccgcctgtgggacccccggatacgtggcc
ccggagctcttggagcagaaaccctacgggaaggctgtggatgtgtgggccctgggtgtc
atctcctacatcttgctgtgtgggtacccccctttctacgacgagagcgatcctgaactc
ttcagccagatcctgagggccagctacgagtttgactctcccttttgggatgacatctca
gaatcagccaaagacttcatccggcaccttctggagcgagacccccagaagaggttcacc
tgccagcaggctttacagcatctttggatctctggggatgcggcctttgacaaggacatc
ctgggctcagttagtgagcagatccagaagaattttgcccggacccactggaagcgagcg
ttcaatgccacctccttcctgcgccacatccgcaagctggggcagagcccagagggtgag
gaggcctcggagaggaggatggcccgccacagccaccctggcctccagtccggccagccc
cccaagtggtga

DBGET integrated database retrieval system