KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378779Help
Entry
101378779         CDS       T05148                                 

Gene name
IRG1
Definition
(RefSeq) cis-aconitate decarboxylase
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    101378779 (IRG1)
Enzymes [BR:oro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     101378779 (IRG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 101378779
NCBI-ProteinID: XP_012421404
UniProt: A0A2U3ZQY6
Position
Unknown
AA seq 450 aa AA seqDB search
MILDTLGVGFLGTSTEVFHKASEYSKIYSSNMSSSVWGRPDLRLPPSYAAFVNGVAIHSM
DFDDTWHPATHPSGAVLPVLMALAEALPSSRTFSGLDLLLAFNVGIEVQGQLLHFSKEAS
DIPKRFHPPSVVGTLGSAAATSKFLGLSMTKCQEALAIAVSHAGAPMANAATQTKPLHIG
NAARHGMESAFLAMLGLQGNKQVLDMQTGFGAFYANYSPQVLPNLDSHMWLLDQQDVAFK
RFPAHLATHWVADAAASVRKHLVTDRALLPTDRVERIVLRIPDVQYVNRPFPDSEHEARH
SFQYVACTTLLDGGVTVPSFHKCQIDRPQVRELLGKVELEHPRDNLPSFNTLYCEVSVTL
SDGATFTECSDTFYGHWRKPLSQEDLREKFRANASSMLSYNTVERLLKIVENLEDLEDCS
VLTTLLKGPSPPEMVSKSIQHLTIPSYNLS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgattctggatactctgggcgttggcttcctgggaaccagtacagaagtgtttcacaaa
gccagcgaatatagtaagatctacagttccaacatgtccagcagtgtttggggtcgacca
gacctaaggctcccgccatcatatgctgcttttgtgaacggtgtggctattcactcaatg
gattttgatgacacatggcatcctgccacccacccttctggagctgtccttcctgtcctc
atggctttagcagaagctctcccttcaagtcgaacattttctggccttgatctgctgctg
gctttcaatgttgggattgaagtacaaggccaattattgcatttctccaaagaagccagt
gacataccaaagagattccatcccccctcagttgtaggaactttgggtagtgcggctgcc
acatccaagtttttagggctcagcatgacaaaatgccaagaggccctggctattgctgtt
tctcatgccggggcacccatggcaaatgctgccactcagaccaagcctcttcatatcggc
aatgctgccaggcatgggatggaatctgctttcctggcgatgctgggtctccaaggaaac
aagcaggtcttggacatgcagacgggctttggggccttctatgccaactactccccacag
gttcttccaaacctagattcccacatgtggctgctggaccagcaggatgtggccttcaag
aggttccctgcacatctggccacccactgggtggcggacgcagctgcgtccgtccgaaag
caccttgtaacagacagagccctgcttcccactgaccgcgttgagagaattgtgctcaga
attccagatgtccagtatgtcaacaggcccttcccagactcagagcacgaagctcgtcac
tcgttccagtatgtggcctgtaccacactgctcgatggtggcgtcactgtcccatccttc
cacaaatgccagatcgacaggccacaggtgagagagttgctcgggaaagtggagctggag
caccctcgggacaacctgccaagcttcaacacactatactgtgaggtaagtgtcactctc
agtgatggagccaccttcacagagtgctcggataccttctatggccactggaggaagcca
ctgagccaggaggacctgcgggagaagttcagagccaatgcctccagcatgctgtcctac
aacacagtagaaaggcttctcaagatcgtagagaatctagaagacctagaagactgttct
gtgctaaccactctgctgaaaggaccctctccaccagagatggtttcaaaatctatccag
catttaacaattccatcgtacaatctctcctga

DBGET integrated database retrieval system