KEGG   Odobenus rosmarus divergens (Pacific walrus): 101378842
Entry
101378842         CDS       T05148                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101378842 (RDH5)
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     101378842 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 101378842
NCBI-ProteinID: XP_004401684
UniProt: A0A2U3W199
Position
Unknown
AA seq 318 aa
MWLPLLLGLLLWAALWSLRDRQSLPASDAFVFITGCDSGFGQLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSVQRAAKWVEAHVGEAGLFGLVNNAGVAGIIGP
TPWLTQNDFHRVLNVNTLGPIGITLALLPLLQQARGRVVNITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAHFGVRVSIVEPGFFRTPVTNLKCLEETLQECWARLPPATQAAYGEA
FLTKYLEVQQRIMNLICDADLTKVSRCLEHALTARYPRTRYSPGWDAKLLWLPASYLPAS
LVDAVLTWVLPKPAQAVC
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggactcttgctctgggcagcgctgtggtcactcagggac
cggcagagcctgcccgccagcgatgctttcgtcttcatcaccggctgtgactcaggcttc
gggcagcttctggccctgagactggaccagagaggcttccgagtcctggccagctgcctg
accccctcaggggcagaggacctacagcgggtggcctcctcccgcctccacaccaccctg
ctggatgtcacggatccccagagtgtccagcgggcagccaagtgggtggaagcacatgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggccgggatcattgggccc
acaccgtggctcacacagaatgatttccatcgggtgctgaatgtgaatacactcggtccc
atcggcatcacccttgccctgctgcccctgctgcagcaggcccggggccgggtggtcaac
atcaccagtgtcctgggtcgcctggcagccaatggtgggggctactgtgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgggatgtggctcattttggggtccgagtc
tccatcgtggagcctggcttcttccgaacccctgtgacaaatctcaagtgtctggaggag
acactgcaggagtgctgggcacggctacctcccgccacacaggccgcctatggggaggcc
ttcctcaccaaatacttggaagtgcagcagcgcatcatgaacctgatctgtgacgcagac
ctgaccaaggtgagcaggtgcctggagcatgccctgactgctcgttaccccagaacccgt
tacagcccaggctgggatgccaagctgctctggctgccagcctcctacctgccagccagc
ctggtggatgctgtgctcacctgggtccttcccaagcccgcccaggcagtctgctga

DBGET integrated database retrieval system