KEGG   Odobenus rosmarus divergens (Pacific walrus): 101379511
Entry
101379511         CDS       T05148                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04080  Neuroactive ligand-receptor interaction
oro04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101379511 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101379511 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 101379511
NCBI-ProteinID: XP_004400280
UniProt: A0A2U3VXS2
Position
Unknown
AA seq 77 aa
MDLRRCVQALLLLWLSLTAACGGPLLRPSDGRGLEEGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atggatctgcggcgctgcgtgcaggcgctcctgctgctctggctctccctgactgcggcg
tgtggagggcccctgctacggccttctgatggcagggggctggaggagggcaacgtccgc
cacctggtgcagcccagaggatcgaggaatggaccggggccctggcagggcggtcggagg
aaattccgccgccagcggccgcgcctctcacacaagggccccatgcctttctga

DBGET integrated database retrieval system