KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380383Help
Entry
101380383         CDS       T05148                                 

Gene name
MRPL53
Definition
(RefSeq) 39S ribosomal protein L53, mitochondrial
  KO
K17434  large subunit ribosomal protein L53
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:oro03011]
    101380383 (MRPL53)
Ribosome [BR:oro03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    101380383 (MRPL53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53
Motif
Other DBs
NCBI-GeneID: 101380383
NCBI-ProteinID: XP_004398788
UniProt: A0A2U3VU54
Position
Unknown
AA seq 112 aa AA seqDB search
MAASLARLGLRSVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRSTNLNCSVIADVRHDGS
EPCVDVLFGDGHRLIMRGAHLTAQEMFTAFASHIQARATAGSGDKPGAGTGR
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccttggctcggctcggcctccgatctgtgaagcaggttcgggttcaattc
tgccccttcgagaagaatgtggagtcaacaaggaccttcctccaggcggtgagcagcgag
aaggtccgttccactaacctcaactgctcggtgattgcggacgtgaggcacgacggctcc
gagccctgcgtggacgtgctgttcggagacgggcatcgcctgattatgcgcggcgctcac
ctcaccgcccaggaaatgttcacagcctttgcctcccacatccaggccagggctacagcg
ggaagcggggacaagcccggcgctggtaccgggcgctga

DBGET integrated database retrieval system