KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380530Help
Entry
101380530         CDS       T05148                                 

Gene name
CARS2
Definition
(RefSeq) probable cysteine--tRNA ligase, mitochondrial
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101380530 (CARS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oro01007]
    101380530 (CARS2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oro03016]
    101380530 (CARS2)
Enzymes [BR:oro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     101380530 (CARS2)
Amino acid related enzymes [BR:oro01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   101380530 (CARS2)
Transfer RNA biogenesis [BR:oro03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    101380530 (CARS2)
 Prokaryotic Type
    101380530 (CARS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 DALR_2
Motif
Other DBs
NCBI-GeneID: 101380530
NCBI-ProteinID: XP_004409652
UniProt: A0A2U3WL50
Position
Unknown
AA seq 567 aa AA seqDB search
MLRTRGAAVGPRLLRAALGLGARLGPARAASGVRGQGWLQPAGHDTGVKVYNSLTRRKDP
LIVGSLDAASWYSCGPTVYDHAHLGHACSYVRFDIIRRILTRVFGCNVIMVMGITDVDDK
IIRRAAEMNVSPASLANLYEEDFKQDMAALKVLPPTVYLRVTENIPQIISFIEGIIANGH
AYPTAQGNVYFDLQSRGDKYGKLVSVVPGPVGEPVDSDKRHASDFALWKVAKPQEVFWAS
PWGKGRPGWHIECSTISSLVFGSQLDIHSGGVDLAFPHHENEIAQCEAFHQCRQWGNYFL
HSGHLHVKGEEKMSKSLKNYITIKDFLKMFSPDVFRLFCMRSSYRSAIDYSDGTMLEAKH
LLLAAAAFVEDARAYMKGQLVCGPIRDDVLWERLRHTKQAVKAALADDFDTPAAVDAVMD
LIHHGNRQLKAHAKEPGGPRSPAVFGSIVSYIEQFFETVGISLAVRQSVSGDDSRATLHS
VVEQLVQFRLQVRQFALASGVATTETRRQELLDTQPLLEACDALRRDLVAHGISIKDRSS
TSTWELIRGQTTSDRRADGPQHRPVLT
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggacgcgcggggcggctgtgggcccccggctcctgcgggccgcgctgggcctg
ggcgcccggctggggccggcgcgggcggcgtcgggggtgcgcgggcagggctggttgcag
ccggcgggccacgacacgggcgtcaaggtgtacaacagcctcacccggaggaaagacccc
ttgatcgtgggcagcttggacgccgcctcctggtatagctgtggaccgactgtctatgat
catgcacaccttggccatgcttgctcgtacgttagatttgatatcatccgaaggatcctc
accagggtttttggatgcaacgtcatcatggtgatgggaatcacagatgtggacgataaa
ataatccgcagagccgctgagatgaacgtgtcacctgcctctctcgccaatttgtatgaa
gaggattttaaacaagacatggcagccttgaaggttctccccccgactgtgtacttgagg
gtaactgaaaatattcctcagatcatttctttcatcgaaggaatcattgctaatgggcac
gcttatccgacagcacaaggcaatgtctactttgacctgcagtcgagaggagacaagtac
ggcaagctggtcagtgtggtccctggtcccgtcggagagccagttgattccgacaagcgg
catgccagcgactttgccctgtggaaggtggccaaaccccaggaggtattttgggcctct
ccttggggaaagggaagaccgggctggcacatcgaatgttccaccatctcaagtctggtg
tttggaagccagctggacatccactcgggcggggtcgatctggcctttccacatcacgag
aacgaaatcgcccagtgtgaggccttccatcagtgcaggcagtggggaaattattttctg
cattctgggcacttgcacgtgaaaggcgaagaaaaaatgtccaaatcgctgaaaaactac
attaccattaaggactttctgaagatgttttcccccgatgtcttccggctcttctgcatg
cggagcagttacaggtcagccatcgactacagtgatggcaccatgctcgaagccaagcac
ctcctcctggcagcagccgcatttgtggaggacgcccgggcctatatgaaggggcagctg
gtgtgcggccccatcagggacgatgtgctgtgggagaggctccgccacaccaagcaggcc
gtgaaggctgccctggcggacgacttcgacacgcccgcggccgtggacgccgtcatggac
ctcattcaccacgggaacagacagctgaaggcgcacgctaaggaacctggcggccccagg
agtcctgccgtgtttggctccatcgtgtcctacatcgaacagttcttcgagaccgtcggg
atttctctggcagtcagacagtctgtttcaggggacgacagccgggccactctgcacagc
gtggtggagcagctggtccagttccggctgcaggtccggcagttcgccctggcctcggga
gtggccaccacggagacccgacggcaggagctgctggacacacagcccctgctggaggcg
tgtgacgctctgcgccgggacctcgtcgcccacggcatcagcattaaggacaggagcagc
acgtccacatgggagctgatcagaggacagacgacctcagaccggcgagctgacggcccc
cagcaccgtcctgtgcttacatga

DBGET integrated database retrieval system