KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380597Help
Entry
101380597         CDS       T05148                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00450  Selenocompound metabolism
oro00970  Aminoacyl-tRNA biosynthesis
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    101380597 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101380597 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:oro01007]
    101380597 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:oro03016]
    101380597 (MARS)
Enzymes [BR:oro01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     101380597 (MARS)
Amino acid related enzymes [BR:oro01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   101380597 (MARS)
Transfer RNA biogenesis [BR:oro03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101380597 (MARS)
 Prokaryotic type
   Other AARSs
    101380597 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 GST_C_2 GST_C Anticodon_1 GST_N_2 GST_N GST_C_3
Motif
Other DBs
NCBI-GeneID: 101380597
NCBI-ProteinID: XP_004401781
UniProt: A0A2U3W1J1
Position
Unknown
AA seq 900 aa AA seqDB search
MRLFVSEGAPGSLPVLAAAGRAQGRAELLISTVGPEVCVVPFLTWPKVPVLQLDSGNYLF
STSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGPVRKA
LTHIDQSLSRRSCPFLAGETESLADIVLWGALYPLLQDPAYLPEELGALHSWFQTLSSQE
PCQRAAETVLKQQGVLALRPYLQKQPQPGSFEGRAVSNEPEEEELATLSEEEIAMAVTAW
EKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNLIGCVLSADVFARYSRL
RQWNTLYLCGTDEYGTATETKAMEEGLTPQEICDKYHAIHADIYRWFNISFDIFGRTTTP
QQTKITQDIFQRLLTRGFVLQDTVEQLRCERCARFLADRFVEGVCPFCGYEEARGDQCDK
CGKLINATELKKPQCKVCRSCPVVKSSRHLFLDLPKLEKRLEEWLGKTLPGSDWTPNARF
IIRSWLRDGLKPRCITRDLKWGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWW
KNPEQVNLYQFMAKDNVPFHGLVFPCSALGAEDNYTLVNHLIATEYLNYEDGKFSKSRGV
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDMLLKNNSELLNNLGNFINRAGMF
VSKFFGGYVPEMVLTSDDRRLLAHVTLELQHYHQLLEKVRIREALRSILTISRHGNQYIQ
VNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSV
LLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGDQARAPPPPAVVGAVAAAAPW
QVQVLTDEVTKQGNIVRELKAQKADKNQVAAEVAKLLDLKKQLALAEGKPLETPKGKKKK
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttcgtgagcgagggcgccccggggagcctgcccgtgctggccgcggcgggc
agggcccagggcagagcggagctgcttatcagcaccgtaggccccgaagtgtgtgtggtc
ccgttcctgacctggcctaaggtccctgtcttgcaactggatagtggcaactacctcttc
tccactagtgcaatctgccgatacttctttctgttatctggctgggagcaagatgacctc
accaaccagtggctggaatgggaagctacggagctgcagccagctttgtctgctgccctg
tactatttagtggtccaaggcaaaaagggggaagatgttcttggcccagtccggaaagcc
ctgactcacattgaccaaagcttgagtcgtcggagctgtcctttcctggctggggagaca
gaatctctagctgacattgttttgtggggagctctatacccattacttcaagacccagcc
tacctccctgaagaattgggtgccctgcacagctggttccagaccctgagttctcaggag
ccatgtcagagagctgcagagactgtgctgaagcagcagggtgtcctggccctccggccc
tacctccagaagcagccccagcctggctcctttgaggggagggctgtcagcaatgagcct
gaggaggaggagttggccactctgtctgaggaggagatcgccatggctgtaactgcttgg
gagaagggcctggaaagcttacccccacttcgaccacagcagaatcctgtgctgcctgtg
gctggggaaaggaatgtgctcatcaccagcgccctcccttatgtcaacaatgtcccgcac
cttggaaacctcattggttgcgtgctcagtgctgacgtctttgccaggtactcccgcctc
cgccagtggaacaccctctatctgtgtgggacagatgagtacggtacagcaacggagacc
aaggctatggaggagggcctgacgccccaggagatctgtgacaagtaccacgccatccat
gccgacatctaccgctggtttaatatctcatttgatatttttggtcgtaccactactcca
cagcagaccaaaatcacgcaggacatcttccagcggttgttgacccgaggttttgtgctg
caagatactgtggagcagctgcggtgtgaacgctgcgcccgcttcctggctgaccgcttt
gtggagggcgtgtgtcccttctgtggctacgaggaggcccggggtgaccagtgtgacaag
tgcggcaagctcatcaatgccactgagctcaagaaacctcagtgtaaagtatgccggtcg
tgccctgtggtgaaatcctctcggcacctgttcctggacctgcctaagctggaaaaacga
ctggaggaatggctggggaagacattgcctggcagtgactggacacccaatgcccggttc
attattcgttcttggcttcgggatggtctcaagccacgctgcataacccgagatctcaaa
tggggaacccctgtacccttagaaggctttgaggacaaggtattctatgtctggtttgat
gccactattggctacttgtccatcaccgccaactacacagaccagtgggagagatggtgg
aagaacccagaacaagtgaacctgtatcagttcatggccaaagacaatgttcccttccac
ggcttagtttttccttgttcagctttaggagctgaggacaactataccttggtcaaccac
ctcattgctacagagtacctgaattatgaggatgggaaattctccaagagccggggcgtg
ggagtgtttggtgacatggcccaggacacagggatccctgctgacatctggcgcttctat
ctgctctacattcgacctgagggccaggacagtgctttctcctggacagacatgttgctc
aagaataattctgaattgcttaacaacctgggcaacttcatcaacagagctgggatgttt
gtgtctaagttttttgggggttacgtgcccgagatggtgcttacttctgatgatcggcgc
ctgctggcccatgtcaccctggaactccagcactatcaccagctgctggagaaggttcgg
atccgggaggccctacgcagtatcctcaccatctctcgccatggcaaccagtacattcag
gtgaatgaaccttggaagcggattaaaggcagtgaggctgacaggcagcgggccgggaca
gtgacaggcctggcagtgaatatcgctgccttgctgtccgtcatgctgcagccttacatg
cccacggtcagtgccaccatccaggcccagttgcagctgccacctccagcttgcagcgtc
ctgctcacaaacttcctgtgcaccttaccagccggacaccagattggcacagtcagtccc
ttattccaaaaactggaaaatgaccagattgaaagtttgaggcagcgctttggtggggac
caggccagagcaccacccccaccagcagttgtaggggctgtggcagccgctgcaccatgg
caggtgcaagtgctgacggacgaggtgacaaaacagggcaacattgtccgagaattgaag
gcgcaaaaggcagacaagaaccaggttgccgccgaggtggctaagctcttggatctgaag
aaacagttggctctagctgaggggaaaccccttgaaacccctaaaggcaagaagaaaaag
tga

DBGET integrated database retrieval system