KEGG   Odobenus rosmarus divergens (Pacific walrus): 101380622Help
Entry
101380622         CDS       T05148                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alcohol dehydrogenase class 4 mu/sigma chain
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00010  Glycolysis / Gluconeogenesis
oro00071  Fatty acid degradation
oro00350  Tyrosine metabolism
oro00830  Retinol metabolism
oro00980  Metabolism of xenobiotics by cytochrome P450
oro00982  Drug metabolism - cytochrome P450
oro01100  Metabolic pathways
oro05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101380622
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101380622
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101380622
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101380622
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101380622
   00982 Drug metabolism - cytochrome P450
    101380622
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    101380622
Enzymes [BR:oro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     101380622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N
Motif
Other DBs
NCBI-GeneID: 101380622
NCBI-ProteinID: XP_004417900
UniProt: A0A2U3X616
Position
Unknown
AA seq 274 aa AA seqDB search
MATGICHTDDHVVKXAMVSKSPGIVGCEAXLERTGGGVTTVKLGDKVIPLFLPLCRECNA
XLNLDGNFCIRNNATGRGAVADGSTRCTCKGKPVCHYMNTSVFTEYTLVHESSIAKTDDA
TPXRVYLIGCGFSTSYGIAIKMSKVGAPRSPCGLNCAVFGLGRXGLSVIMGCKLAGAPRF
LGIDLNKDKFEKAISMGATKCIKPQXLEPLGAMLSEMTGDTVAYSFEVTGHLERIDALAS
CYGTSIVEGAPPXVNMLTHDPLLLLTGHNMDRIF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggccacaggaatctgtcacacagatgaccacgtggtaaaatgagcaatggtgtctaag
tctccagggattgtgggatgtgaagcannactggagagaactggaggaggagtcactaca
gtgaaactgggtgacaaagtcatccccctctttttgcctctatgcagagaatgcaatgct
nttctcaatctggatggcaacttttgcattaggaataacgctactggtcgtggagcagtt
gctgatggttctaccagatgtacctgcaagggcaaaccagtctgtcactacatgaacacc
agtgtgtttactgagtacacactggtgcatgaatcttccattgctaagactgatgatgca
actcctnnaagagtctatttaattggatgtggattttctactagctatgggattgccatt
aaaatgagcaaggtaggggcacccaggtcaccctgtggtttaaattgtgcagtctttggc
ctgggaaggnatggcctttcagtcatcatgggctgtaagctggctggggcacccaggttt
cttggaattgacctgaacaaagacaaatttgagaaggccatatctatgggagccaccaag
tgcatcaaaccccagnnactcgagccccttggtgcgatgctgtcagaaatgacaggtgac
accgtggcctacagttttgaagtcactgggcatcttgaaaggattgatgcccttgcatcc
tgctatggaaccagcatagtggaaggtgctcctccatgagtcaacatgctcacccatgac
cctctgctgctcctcactggacacaacatggataggatattttag

DBGET integrated database retrieval system