KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382257
Entry
101382257         CDS       T05148                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oro01009]
    101382257 (AKAP5)
Protein phosphatases and associated proteins [BR:oro01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     101382257 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 101382257
NCBI-ProteinID: XP_004409422
UniProt: A0A2U3WKK8
Position
Unknown
AA seq 428 aa
METMVSEIQVESKDEKRPTEVSPQDERQEERASMLCFKRRKKASKAVKPKASSEAAGTAR
KCPPEAGATEQPRPPGGAWASIKRLVTRRKRSDSSKQQKPFEAKVQPEISAEDADLSKKK
AKSGLKIPFIKFSKGEKRSNHSKIIEDSDCSLRIQGEAEHLDTKAPAQSDDQAIKTKLPQ
DISKDVSRKEGDEVCEPNVSNSTTTAGEKVVSVELGLDTGRSAIHPGALILERDTETTEE
KQSVRPQQASPLETSETEHQPPVVSDVPPSPAIPDQQIVEEARSNILESGPNWGEHDSRE
IIAEESEQKDTELSQESELRENEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKQFLISIENEQVGVFANDSGFEGRTSEQYEKLLIETASSLVKNAIQLSIEQLVNEMASD
DNKMNNLL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggaaaccatggtttccgaaattcaagttgaaagcaaggatgagaagagacccacagaa
gttagtcctcaagatgagaggcaggaggaaagagcatcaatgctttgcttcaagagaaga
aagaaagcaagcaaagcagtgaagcccaaagctagctctgaggctgctggcacagcaaga
aagtgtcccccagaagcaggagctaccgagcagccacggcccccagggggggcctgggcc
tcaatcaaacgtcttgtaacacgcaggaaaaggtcagactcttcaaagcagcaaaagccc
tttgaggccaaagtgcaacctgaaatcagtgctgaggatgctgatctttctaagaaaaag
gcaaaatccgggcttaagattcccttcataaaattctcaaaaggagagaaacgaagtaat
cattccaaaattatagaagactcagactgtagcctcagaatccagggagaggctgaacat
ttggatacaaaagctccagcccaatcagatgaccaggcaataaagaccaagttgccccag
gatataagtaaagatgtctcacggaaagagggtgacgaggtctgtgaaccaaatgtgagc
aacagcacaactacagctggagaaaaagtggtttcagtagaacttgggttagatacgggg
cgttctgccattcacccaggagcactaatccttgaaagagataccgaaacgacggaggaa
aaacaaagtgtccgaccccagcaagcaagcccacttgaaacttcagaaacagaacatcag
ccaccagtggtttctgatgttcctccctcacctgcaatcccagatcagcaaattgtggaa
gaagccagaagcaatatcctagaaagtggaccaaactggggagagcatgacagtagagag
attatagctgaagagagtgagcaaaaagacactgaattgagccaggaatcagagctgaga
gaaaatgaggtcactgcagagaaacccaaaccagaagaaagcaaaagaatggagccaatt
gctattattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagcaattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgatagt
ggttttgagggtagaacttcagaacaatacgaaaaactcttaatagaaacagcttcttct
cttgtcaagaatgctatccaattgtctatagaacagctggttaatgaaatggcctctgat
gataataaaatgaacaatcttctatag

DBGET integrated database retrieval system