KEGG   Odobenus rosmarus divergens (Pacific walrus): 101382351Help
Entry
101382351         CDS       T05148                                 

Gene name
STMN3
Definition
(RefSeq) stathmin-3 isoform X3
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
SSDB OrthologParalogGFIT
Motif
Pfam: Stathmin HrpF Exonuc_VII_L
Motif
Other DBs
NCBI-GeneID: 101382351
NCBI-ProteinID: XP_004410172
UniProt: A0A2U3WMF0
Position
Unknown
AA seq 180 aa AA seqDB search
MASTLSAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPVLSSPPKRKDTSLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccctgtccgcctacaaggagaagatgaaggagttgtcagtgctgtcgctc
atctgctcctgtttctactcgcagccgcaccccaacaccatctaccagtatggggacatg
gaggtgaagcagctggacaagagggcctctggccagagcttcgaggtcattctcaagtcc
ccttctgacctgtccccggagagcccagtgctctcctctccccccaagaggaaggacacc
tccctggaggaactgcagaagcggctggaggcagctgaggagcgaaggaagacgcaggag
gcgcaggtgctaaagcagctggctgagcggcgcgagcacgagcgcgaggtgctgcacaag
gcgctggaggagaacaacaacttcagtcgcctggcggaggaaaagctcaactacaagatg
gagctcagcaaggagatccgcgaggcgcacctggcggcgctgcgcgagcggctgcgcgag
aaggagctgcacgcagctgaggtgcgcaggaacaaggagcagcgagaggagatgtcgggc
taa

DBGET integrated database retrieval system