KEGG   Odobenus rosmarus divergens (Pacific walrus): 101383146
Entry
101383146         CDS       T05148                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oro03000]
    101383146 (AHRR)
Transcription factors [BR:oro03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101383146 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 101383146
NCBI-ProteinID: XP_004411674
UniProt: A0A2U3WR85
Position
Unknown
AA seq 728 aa
MIPPGECTYAGRKRRKPVQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVSK
LDKLSVLRLSVSYLRVKSFFQVVQSVGPRQPGVSAPSPEDRGLSARSAVLEGRLLLESLD
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPHV
VFGQPLHSETGGSLEDAVLGRLLRAQEGGAGSPTDFSAFLTRCFVCRVRCLLDSTSGFLT
MQFQGKLKFLFGQKRKAPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRMDVS
ASMDTKARAATSPCEPEFHGKPSYFAGRNNGENIPVLRTQADAGRWARVPARAPCLCLRN
GPDLVSDPEGAAGDRSGDEHGRVPSGSSGARGRREIHAYSCCFEAPGPVKHLSWMTGKHG
QDGGTKLKLEPSKSDPFSMRAVSLGSCVPCPGVQGAVHTSGVTAFRNSPSCHPGSHSPSA
YTSRTSRTSRALRDSDQGQVHPPPSCPFPQGSLDNGFPQPRGQRLTAVGHSIEDTKFRGG
PMPSGAPCNPILSLDVPIKMETDSGSEDAADGYSMSPSQVWLGASGMAKRQLVTFPTRMH
LKTEPEARHHLYAPHLGHSLLEAHPSGRAPLRPGRELAPFHPAHCACLEHVHGLPEPDRP
HHFCAQGHQPPALGCDCRAPGTTPIVKREPLDSPLWASHSQGGVPGMFPKSAVATLMPPK
APECAFLP
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatcccaccaggggagtgcacgtatgctggaaggaaaagaagaaagcccgttcagaaa
cagaggcccgccacgggggccgagaagtcaaacccttccaagaggcaccgggaccggctc
aatgccgagctggaccacctggccagcctgctgccgcttcctcccgacattgtgtctaag
ctagacaagctttctgtcctgcgtctcagcgtcagctacctcagggtgaagagcttcttc
caagtcgtgcaaagtgtgggcccacggcagccaggggtcagtgccccctcccccgaagac
cgtggtctgagcgcaagatctgctgtgctggagggaaggctgctgctggagtctctcgat
ggctttgccctggtcgtgagtgcagaaggcatgatattttatgcttcagcaacaatcgtg
gactatctgggcttccaccagacggatgtgatgcaccaaaacatttatgactatatccac
gtggatgaccgccaggacttctgccggcagctccactgggccatggaccctccccacgtg
gtgtttgggcagcccctgcactcagagacaggtgggtctttggaggacgccgtcctgggg
aggctgctgcgcgcgcaggagggaggcgcgggctcgcccacggacttctcggccttcctg
acgcgctgcttcgtgtgccgcgtgcgctgcctgctggacagcacctcgggctttctgacg
atgcaatttcaaggaaaactaaaattcctgtttggacagaagaggaaagcgccgtcgggg
actgtcctgccccctcggctctcactgttctgcatcgtggtgcctgtcctcctgccctct
gtggcggagatgaaaatgaagagcgcgtttttgagggtgaagcacaggatggacgtctca
gcctctatggacacaaaagcaagagctgctacaagtccatgtgaaccagaattccacggg
aaacccagttactttgcagggaggaacaacggagaaaacattccagtgctcaggacacag
gcggatgcaggacgctgggcccgggttccagccagggccccatgtctgtgcctcagaaac
ggccctgacctcgtttctgaccctgagggggccgcaggggacaggtcaggagacgagcac
gggagggtgcccagcggctcctcaggagccaggggtcggagggagatacatgcatacagt
tgctgctttgaggcaccgggacccgtgaagcacctgagctggatgacagggaaacatggc
caggatgggggtaccaagctgaagctggagcccagcaagagtgacccgttctccatgcgt
gctgtgtcccttggttcctgcgtgccctgcccaggcgttcagggcgctgtccacaccagt
ggggtaactgctttcaggaattcacccagttgtcacccaggaagccattctcccagtgcc
tacaccagccgcaccagccgcaccagcagagctttgcgggacagcgatcagggccaggtg
caccctccacccagctgccccttcccccaagggagcctggacaatgggtttcctcagccc
agagggcagcgtcttacagcagtgggccattctatcgaggacaccaagtttcgaggtggg
ccaatgccctcgggagctccgtgcaaccccatcttgtcacttgatgtgcccatcaagatg
gagactgactctgggtctgaggatgcagcagatggctactccatgtccccaagccaggtg
tggttgggagccagtggtatggccaagagacagctggtcactttccctaccaggatgcac
ctgaaaacagagccggaagccaggcaccacctgtatgctccgcacctggggcacagcttg
ctggaagctcacccgagtggcagggctccgctcagacccggcagggagctggcccccttc
caccccgcacactgtgcatgcctggagcatgtgcatggtcttcctgagccagatcgtccc
caccacttctgtgcacagggtcaccagccccctgcactgggctgtgactgcagagctccg
gggactacgcccatcgtcaaacgagagcccctggactcaccgctatgggccagtcacagc
cagggcggggtgcctggaatgttccccaaaagtgctgtggcaactctgatgcctcccaaa
gcgcccgagtgtgctttcctgccataa

DBGET integrated database retrieval system