KEGG   Odobenus rosmarus divergens (Pacific walrus): 101384844
Entry
101384844         CDS       T05148                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro00230  Purine metabolism
oro00240  Pyrimidine metabolism
oro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101384844 (DCK)
   00240 Pyrimidine metabolism
    101384844 (DCK)
Enzymes [BR:oro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101384844 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 AAA_17 CoaE
Other DBs
NCBI-GeneID: 101384844
NCBI-ProteinID: XP_004392960
UniProt: A0A2U3VE62
Position
Unknown
AA seq 260 aa
MATPPKRSCPSPATGSEGTRIKKIAIEGNIASGKTTFVNILKQVCEDWEVVPEPVARWCN
VQSAQGDCEELTASQESGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFASNLYESDCMNETEWTIYQDWHDWMNQQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILTLDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccacaccaccgaagaggagctgcccatctcccgcgaccggctctgaggggacccgc
atcaagaaaattgccatcgaagggaacatcgcttcagggaaaacaacatttgtgaatatc
ctaaaacaggtctgcgaggattgggaggtggttcctgaacctgttgccaggtggtgcaat
gttcaaagtgctcaaggtgactgtgaggaactgacagcatctcaggaaagtggtggaaat
gttcttcagatgatgtatgagaaacctgaacggtggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatacagtgacaggtatgtctttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaatcaacagtttggccaaagccttgaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttacgaggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctactgcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctattttaacactggatattaatgaa
gactttaaagacaaacacgacggtctgattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system