KEGG   Odobenus rosmarus divergens (Pacific walrus): 101385761Help
Entry
101385761         CDS       T05148                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04010  MAPK signaling pathway
oro04260  Cardiac muscle contraction
oro04261  Adrenergic signaling in cardiomyocytes
oro04921  Oxytocin signaling pathway
oro05410  Hypertrophic cardiomyopathy (HCM)
oro05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
oro05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:oro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101385761 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101385761 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101385761 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    101385761 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101385761 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101385761 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    101385761 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101385761 (CACNG5)
Ion channels [BR:oro04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101385761 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 COPI_assoc DUF716
Motif
Other DBs
NCBI-GeneID: 101385761
NCBI-ProteinID: XP_004415825
UniProt: A0A2U3X1J3
Position
Unknown
AA seq 275 aa AA seqDB search
MSGCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSMEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDTSLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ctgggtctcctgggcatcgcagtcagcaccgactactggctctacctggaggagggcgtg
gtcctgccccagaaccagagcatggagatcaagatgtccctgcactcgggcctgtggcgt
gtctgcttcctcgcaggtgaggagcggggacgctgcttcaccatagagtatgtgatgccc
atgaacactcagttgacatcagagtccacggtcaatgttctaaaaatgattcgctcggcc
acaccgttccccctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatc
ggacacatccgtccccacaggacaatactggcctttgtctctggcatcttttttattctc
tcaggcctctctctggtggtgggccttgtgctctacatctccagcatcaacgatgagatg
ctcaacaggaccaaggacgcagagacctatttcaactacaagtacgggtggtccttcgcc
ttcgctgccatctcgttccttttgacagagagcgcgggggtgatgtccgtgtacctgttc
atgaagcggtacaccgccgaggacttgtacaggccccaccccggcttctaccggcctcgc
ctgagcaactgctctgattactcaggccagttcctacacccggacgcctgggtccggggc
cgcagcccctccgacatctccagtgacacctccctgcagatgaacagcaactacccagcc
ttgctcaagtgccccgactatgaccagatgtcatcttccccctgctga

DBGET integrated database retrieval system