KEGG   Odobenus rosmarus divergens (Pacific walrus): 101386486
Entry
101386486         CDS       T05148                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
oro  Odobenus rosmarus divergens (Pacific walrus)
Pathway
oro04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:oro00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101386486 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oro04040]
    101386486 (ASIC1)
Ion channels [BR:oro04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   101386486 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 101386486
NCBI-ProteinID: XP_004400896
UniProt: A0A2U3VZB5
Position
Unknown
AA seq 562 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQRQRQRQWDNSESEEEEEEKEEEAVRKEPREG
DSPMDLVAFANSCTLHGASHIFVEEGPGPRQAVWAVAFVLALGAFLCQVGDRVAYYLSYP
HVTLLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGP
EAFSGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGR
PRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFG
VAPGFQTFVSCQEQRLIYLPPPWGTCKAVTMDSDFFDSYSITACRIDCETRYLVENCNCR
MVHMPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKAS
AKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGAS
ILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAG
MTYAANILPHHPARGTFEDFTC
NT seq 1689 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctctgtgtccttctcctctggagaggaggccccagggccc
ttgggagatgtttggggtccccaccagcggcagcggcagcggcagtgggacaactcagaa
tcagaagaggaggaagaagagaaggaagaggaggcagtgaggaaggagcctagagagggg
gattcgcccatggatttggtggcctttgccaacagctgcaccctgcacggcgccagccac
atcttcgtggaggagggtccggggccgaggcaggccgtgtgggcagtggcctttgtcctg
gccctgggcgccttcttgtgccaggtgggggaccgcgtcgcctattacctcagctacccg
cacgtgactctgctggacgaggtggccaccacggagctggccttcccggccgtcaccctc
tgcaacaccaatgccgtgcgcctgtcccagctcagctaccccgacttgctctacctggcc
cccatgctggggctggatgaaagtgatgaccctggggtgcccctcgccccaccggggccc
gaggccttctctggggagccctttaacctgcaccgcttctacaatcgctcctgccaccgg
ctggaggacatgctgctctattgctcctactgcggggggccctgtggccctcacaacttc
tcggtggtcttcacacggtatggcaagtgctacacattcaactcgggccgagatgggcgt
ccacggctgaagaccatgaagggtgggactggcaatgggctggagatcatgctggacatc
cagcaggacgagtacctgcctgtatggggagagactgatgagacgtccttcgaagcgggc
atcaaagtgcagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggt
gtggccccggggttccagacctttgtgtcctgccaggagcagcggctcatctacctgccc
ccgccctggggcacctgcaaagctgttaccatggactcggatttcttcgactcctacagc
attactgcctgccgcatcgactgtgagacacgctacctggtggagaactgtaactgtcgc
atggtgcacatgccaggggatgccccatactgcactccagaacagtacaaggagtgtgcg
gatcctgctctggacttcctggtggagaaggaccaggagtactgtgtgtgtgaaatgccc
tgcaacctaacccgctatggcaaggagctgtccatggtcaagatccccagcaaagcatca
gccaagtacctggccaagaagttcaacaagtctgagcagtacataggggagaacatcctg
gtgctggacattttctttgaagtcctcaactatgagactattgagcagaagaaggcctat
gaaattgcagggctcctgggtgacattgggggccagatggggctgttcattggggccagc
atcctcacggtactggagctctttgactacgcctatgaggtcatcaagcacaagctgtgc
agaagaggaaagtgccagaaggaggccaaaaggagcagcgcggacaagggtgtggccctt
agcctggatgacgtcaaaagacataacccatgtgagagcctccggggccaccccgccggg
atgacgtatgctgccaacatcctacctcaccatccggcccgaggcacttttgaggacttt
acctgctga

DBGET integrated database retrieval system