KEGG   Ornithinimicrobium sp. H23M54: FNH13_06065Help
Entry
FNH13_06065       CDS       T06094                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
orz  Ornithinimicrobium sp. H23M54
Pathway
orz00020  Citrate cycle (TCA cycle)
orz00480  Glutathione metabolism
orz01100  Metabolic pathways
orz01110  Biosynthesis of secondary metabolites
orz01120  Microbial metabolism in diverse environments
orz01130  Biosynthesis of antibiotics
orz01200  Carbon metabolism
orz01210  2-Oxocarboxylic acid metabolism
orz01230  Biosynthesis of amino acids
Module
orz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
orz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:orz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FNH13_06065
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FNH13_06065
Enzymes [BR:orz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FNH13_06065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: QDO87965
UniProt: A0A516G8Z7
Position
1312583..1313803
Genome map
AA seq 406 aa AA seqDB search
MEKIKVANPIVELDGDEMTRIIWQFIKDRLIHPYLDVDLKYFDLSVEKRDETNDQITIDA
AHAIKEHGVGVKCATITPDEARVEEFGLKEMWKSPNGTIRNILGGVIFREPIIISNVPRL
VPGWTKPIIIGRHAHGDQYKAQNFKVPGPGTVTITYTPADGGEPEVHEVAKYGEDGGVAM
GMFNYNDSIRDFARASLNYALDRGVPCYLSTKNTILKAYDGAFKDIFQEVFDAEFKEKFH
AADLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKQTSTNPIASIFAWTRGISYRGKMDNTPEVTEFAETLE
RVCIETVESGKMTKDLALLVGPNQKWLTTEEFLAAIDENLQKAMAA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatcaaggtcgccaacccgatcgtcgagctcgacggtgacgagatgacccgc
atcatttggcagttcatcaaggaccggctgatccacccctacctcgacgtcgacctgaag
tacttcgacctcagtgtcgagaagcgtgacgagaccaacgaccagatcaccattgacgcg
gcccacgcgatcaaggagcacggcgtcggcgtcaagtgcgcgacgatcacccccgatgag
gcccgggtcgaggagttcggcctcaaggagatgtggaagagcccgaacggcaccatccgc
aacatcctcggcggcgtgatcttccgcgagccgatcatcatctccaacgtcccgcgactg
gtgccgggctggaccaagccgatcatcatcggccgtcacgcccacggtgaccagtacaag
gcgcagaacttcaaggtgccggggccgggcaccgtcaccatcacgtacaccccggccgac
ggcggcgagccggaggtccacgaggtcgcgaagtatggcgaggacggtggtgtcgcgatg
ggcatgttcaactacaacgactcgatccgcgactttgcccgggccagcttgaactacgcc
ctggaccgtggcgtcccgtgctacctgtcgaccaagaacaccatcctgaaggcctatgac
ggtgcgttcaaggacatcttccaggaggtcttcgacgcggagttcaaggagaagttccac
gccgcggacctgacctatgagcaccgcctcatcgacgacatggttgctgccgcgatgaag
tgggagggcggctatgtctgggcctgcaagaactatgacggcgacgtccagtccgacacc
gtggcccagggcttcggcagcctcggcctgatgacctccgtgctgatgaccccggacggc
aagaccgtcgaggccgaggctgcacacggcaccgtcacccggcactaccgtcagcaccag
cagggcaagcagacatccaccaacccgatcgcctcgatctttgcgtggacccgtggcatc
tcctaccgcggcaagatggacaacacccccgaggtgaccgagttcgccgagaccctcgag
cgggtctgcatcgagacggtcgagtcgggcaagatgaccaaggacctggcactgctcgtc
ggcccgaaccagaagtggctgaccaccgaggagttcctcgccgcgatcgacgagaacctg
cagaaggcgatggctgcctga

DBGET integrated database retrieval system