KEGG   Ornithinimicrobium sp. H23M54: FNH13_18835Help
Entry
FNH13_18835       CDS       T06094                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
orz  Ornithinimicrobium sp. H23M54
Pathway
orz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:orz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FNH13_18835 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:orz03400]
    FNH13_18835 (recC)
Enzymes [BR:orz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FNH13_18835 (recC)
DNA repair and recombination proteins [BR:orz03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FNH13_18835 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: QDO90127
UniProt: A0A516GF18
Position
4079475..4082936
Genome map
AA seq 1153 aa AA seqDB search
MTLFVHRATSTDVLADGLAELLATPLEDPFAEEVVAVPAKGVERWLAQRLSHRLGAGPGG
GDGVCAGVRFLNPHSLVSLVLGIERDDPWHPEQLTWPVLRAIDESLGEDWATPLAVHLGT
RGADDDTEAELRRGRRYAVARRLAGILSSYAEQRPSLIADWRSGGSGDGLGGPLPDDLAW
QPHLWRRVLELVDADPPEVRRDRVVTALRAGGEPAGLELPGRLSLFGHTRIASSEVSVLE
ALAAHRDVHLWLPQASPAAWDRLTEAVAQGPVVRTADDSVVVVEHPLLASLGRDMRELQR
TLAPAGAVDRPLGQLLTTTTASPPTTLLGWLQDDLRRDRQPEADEVAGRVLETDDDSVQV
HACHGRGRQVQVLRDVLAGLLQDRPDLEPRDILVMCPDIDAYAPLVHAGFGLGEVVREVD
AHPAHGLRVMLADRAPRHTNPLLALASQLVALAGSRLTTSEVLDLARSAPVRRRFGLDDD
ALERIGTWVEEVAVRWGLDAEHRGRYALANFGQNTWRTGLDRVLTGAVLDGQEVTHLGHT
LALDDLDSGDINLAGRLAELVDRLGGTLRDLHGCQHAHEWTRVLLEGVRGLADVPGEDEW
QVTQLERELARIADAARRDTGSTTLALSDIRAMLQEHLAGRATRSSFRTGTLTICTMVPM
RSVPHKVVCLVGLDDGVFPRTTAADGDDALARRPVTGERDTRAEDRQLLLDAVMAAQDTL
VITYTGADEHSGAPRPPAVPLGELLDALHETASRPGGAGPLVRHHPLQPYDVRNLGGVAP
DLPPLRPDAMPFSFDPCALAGAEAALSRPAVPETGGGASWLVDEPLRERVEQSRDVDLED
LQRFLAQPAQGFLRQRLGLLLPDQPEESAEGIPIELDGLERWKIGDRMLRAVLAGAHPDD
SRQQELWRGSVPPGELGRAVLEEVDERVRNIARAAMPHLESPGDIIDLDIALPSGRRLTG
TIGPLHGTPPGVVIATYSTIRAKQRLRSWVTALALAAHGQTWPTSQVIGQMRQGRNPRVV
RMTHGPVDPDTALRLLGELVDVYDRGMRTPLPLGVQSAAAFAESYASNGDEKGALTDASK
KWETTTGWYTSVGEQDDPAFRRVFGDGARLVDLAGVAGEDEVWSERIHTRFGQFALRVWL
PLLTDGPESKAWM
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttgttcgtgcaccgagcgaccagcaccgacgtgctggccgacgggctcgccgag
ctcctcgcgacgccgctggaggacccgttcgccgaggaggtcgtcgccgtgcccgccaag
ggtgtcgagcggtggctggcgcagcggctctcgcaccggttgggtgccggacccgggggt
ggcgacggggtctgcgccggggtgcgcttcctcaacccgcactcgctggtctccctcgtg
ctgggcatcgagcgggacgatccctggcatcccgagcagctcacctggccggtcctgcgc
gcgatcgacgagagcctgggtgaggactgggccacgccgctggccgtgcacctgggcacg
cggggtgcggacgacgacaccgaggccgagctgcgccgtgggcgccgctatgccgtggcg
cgccgactcgcgggcatcctcagctcgtatgccgagcagcgcccctccctcatcgccgac
tggcgctccgggggctcgggcgacggactgggtggaccgctccccgacgacctcgcctgg
cagccccacctgtggcgccgggtgctcgagctggtggacgcggacccgcccgaggtgcgg
cgcgaccgggtcgtgaccgcgctgcgcgcaggtggcgagccggccggactcgagctcccg
ggccgcctgtcactgttcgggcacacccgcatcgccagcagcgaggtctcggtgctggag
gcgctggcggcgcaccgggacgtgcacctgtggttgccgcaggcctcccccgctgcctgg
gaccggctgaccgaggccgtggcgcagggtccggtcgtgcgcaccgctgacgactcggtg
gtcgtcgtcgagcaccccctgctggcctcgctgggccgggacatgcgtgagcttcagcgc
acgctggctcctgccggtgccgtggaccggccgctgggtcagttgctgaccaccacgacc
gcctcgccgccgacgacgctgctcggctggttgcaggacgacctgcgtcgcgaccgccag
ccggaggccgacgaggtggcaggccgggtgctcgagaccgacgacgactccgtgcaggtg
cacgcttgccacgggcgcgggcgtcaggtgcaggtgctgcgcgatgtgctggccggcctg
ctgcaggaccggcccgacctcgagccgcgggacatcctggtgatgtgccccgacatcgac
gcctacgccccgctggtgcacgccggcttcgggctcggcgaggtggtccgggaggtcgat
gcccacccggcccacggcctgcgggtgatgctcgcggaccgcgcgccccggcataccaac
cccctcctggcgctcgcgtcacagctggtggcgctggccgggtcgcggctgaccaccagc
gaggtgctcgacctggcacggtcggcaccggtgcgtcggcggttcggcctggacgatgac
gctctggaacggatcggcacctgggtcgaggaggtggccgtgcggtggggcctggacgcc
gagcaccgcggccgttatgcactggccaactttggccagaacacctggcgcaccggcctc
gaccgggtgctgaccggcgcggtgctcgatggccaggaggtgacccacctcggccacacg
ttggctctcgacgacctcgacagcggcgatatcaacctggccgggcggcttgccgaactg
gtcgaccggctcggtggcaccctgcgcgacctgcacgggtgccagcacgcccacgagtgg
acgcgggtcctgctcgagggggtgcgcggcctggccgacgtgccgggcgaggatgagtgg
caggtgacgcagctggagcgcgagctcgcccgcatcgccgacgccgcgcgccgggacacc
gggtcgacgacgctggcgctgtctgacatccgcgccatgctgcaggagcacctggcgggg
cgtgcgacgcgctccagcttccgcaccggcacgctcacgatctgcacgatggtgccgatg
cgctccgtgccgcacaaggtggtgtgcctggtcggtctggacgacggagtcttcccacgc
accaccgccgccgacggtgacgacgccctcgcccggcgcccggtcactggcgagcgcgac
actcgtgccgaggaccggcagctgctgctggacgccgtcatggccgcccaggacacgctg
gtcatcacctataccggtgccgacgagcacagcggcgcgccgcggcctcccgctgtcccg
ctcggcgagttgctcgacgccctccacgagaccgcatcgcgtcccggtggtgccgggccc
ctcgtgcggcaccacccgctccagccctatgacgtgcgcaacctgggcggggtggcgccg
gacctgccgccgctgcggcccgacgcgatgccgttcagttttgacccgtgcgccctcgct
ggcgccgaggccgcgctgtcccgtcccgcggtgcccgagacaggcggtggcgcctcgtgg
ctggtcgacgagcccctccgggaacgggtggagcagtcccgcgacgtggatctggaggac
ctccagcggttcctggcccagccggcccagggcttcctgcggcagcgactggggctgctg
ctgccagaccagcccgaggagtcggccgaggggatccccatcgagctggacggtctggag
cgatggaagatcggcgaccgcatgctgcgggcggtgctggccggtgcgcatcccgacgac
agccgtcagcaggagctgtggcgggggtcggtgcctcccggagagctgggccgcgcggtg
ctcgaggaggtggacgagcgggtccgcaatattgcccgtgccgccatgccccacctcgag
tcacccggcgacatcatcgacctcgacatcgccctcccctccggtcgccggctgaccggg
acgatcggtccgctgcacggcacaccaccgggggtggtcatcgcgacctactccacgatt
cgggccaagcaacggttgcgctcgtgggtgaccgccctggcgctcgctgcccacggccag
acctggccgaccagccaggtgatcggacagatgcggcagggccgcaaccctcgcgtggtg
cgcatgacccacgggccggtcgaccctgacaccgcgctgcgcctgctcggcgaactggtc
gacgtctatgaccgaggcatgcggaccccactccctctcggtgtgcagtcggccgccgcc
tttgccgagtcctatgcctccaacggcgacgagaagggcgccctgaccgacgcgagcaag
aagtgggagaccacgacgggctggtacacctcggtcggcgagcaggacgacccggccttc
cgccgggtcttcggcgacggtgcgcggctcgtcgacctcgccggggtggcgggcgaggat
gaggtctggagcgagcgcatacacacccggttcgggcagttcgccttgcgggtctggctc
ccccttctcaccgacggacccgagagcaaggcgtggatgtga

DBGET integrated database retrieval system