KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 107276369
Entry
107276369         CDS       T01015                                 

Definition
(RefSeq) putative Peroxidase 48
  KO
K00430  peroxidase [EC:1.11.1.7]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00940  Phenylpropanoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107276369
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     107276369
SSDB
Motif
Pfam: peroxidase
Other DBs
NCBI-GeneID: 107276369
NCBI-ProteinID: XP_015621792
UniProt: Q5U1S5 A2ZX60
Position
1
AA seq 366 aa
MRRPDPATGLRFAAVSLILCTANICAVARRSSYALLLDDEEDGGGGGDGSASFSFFPQTQ
PRGLVYGFYDESCPDAEGIVSSTVRELYLANPNVAAALVRLFFHDCFIHGCDASVLLDRI
NGDKSEREAAPNQSLRGFGAVDKIKARLEAACPRTVSCADILVLAARDSLVLAGGPSYPV
LTGRSDSARAFYDEVGARIPSPNATYTVTLDAFARRGFTERETVALLGAHSIGKVHCRFF
KDRIDNFAGTGEPDDTIDADMVEEMRAVCDGDGAAPMEMGYYRQGREVGFGAHYYAKLLG
GRGILRSDQQLTAGSTVRWVRVYAAGERGEEVFREDFAHAMVKLAALEPLTGSPGHVRIR
CSKPVE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgacggcctgatccggcgactggcttgcgctttgcggccgtctcgctgatcctgtgc
acggccaacatctgtgcggtggccagacggtcgtcgtacgcgctcctgctcgacgacgag
gaggacggcggcggaggcggtgacggctcggcgtccttctccttcttcccgcagacgcag
ccgcgcgggctggtgtacgggttctacgacgagagttgccccgacgccgaggggatcgtg
tcgtccaccgtgcgggagctctacctcgccaaccccaacgtcgccgccgcgctcgtccgc
ctcttcttccacgactgcttcatccacggctgcgacgcctcggtgctcctggaccgcatc
aacggcgacaagtcggagagggaagcggccccgaaccagtcgctgagaggcttcggcgcc
gtcgacaagatcaaggcgaggctggaggcggcgtgcccgcggaccgtctcctgcgccgac
atcctggtcctcgccgcgcgggacagcctcgtcctagcgggcgggccgagctatcccgtg
ctcaccggacgcagcgacagcgccagggccttctacgacgaggtgggcgcgcgcatcccg
tcgccgaacgccacctacaccgtgacgctcgatgcgttcgcccgccgcggcttcaccgag
cgcgagaccgtcgcgctcttaggagcacatagcatcgggaaggtgcattgcagattcttc
aaggacaggatcgacaacttcgccgggacaggcgagcctgacgacaccatcgacgccgac
atggtcgaagagatgcgcgcggtgtgcgacggcgacggcgccgcgccgatggagatgggg
tactaccggcaggggagggaggtgggtttcggcgcgcactactacgcgaagcttctcggt
ggacggggcatcctgcggtcggaccagcagctcacggcggggagtaccgtgcggtgggtg
cgcgtgtacgcggccggggagcgcggcgaggaggtgttccgcgaggacttcgcgcacgca
atggttaagcttgccgcgcttgagccgctcaccgggtcgcccggccacgtccggatccgc
tgctccaaacccgtggagtag

DBGET integrated database retrieval system