KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324062Help
Entry
4324062           CDS       T01015                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00071  Fatty acid degradation
osa00410  beta-Alanine metabolism
osa00592  alpha-Linolenic acid metabolism
osa00640  Propanoate metabolism
osa01040  Biosynthesis of unsaturated fatty acids
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
osa01200  Carbon metabolism
osa01212  Fatty acid metabolism
osa04146  Peroxisome
Module
osa_M00087  beta-Oxidation
osa_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4324062
  09103 Lipid metabolism
   00071 Fatty acid degradation
    4324062
   00592 alpha-Linolenic acid metabolism
    4324062
   01040 Biosynthesis of unsaturated fatty acids
    4324062
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4324062
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    4324062
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     4324062
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 4324062
NCBI-ProteinID: XP_015622170
UniProt: Q5ZEL4
Position
1
AA seq 433 aa AA seqDB search
MAGKQGDGREEDGAKVGLPALDISLAFPQATPASIFPPSASDYYQIDDLLTTEEQSIRKN
VRAIMEKEIAPIMATYWEKAEFPFHAIPKLSSLGVAGGTIKGYGCPGLSITASAITMAEI
ARVDASCSTFILVHSSLAMVTIALCGSEVQKQKYLPSLAQLTAVGCWALTEPNHGSDASS
LITTATKVPGGWHIDGQKRWIGNSTFADVLVVLARNANTKQLNGFIVRKGAPGLKATKIE
NKIGLRMVQNGDIVFNKVFVPEEDRLPGVNSFQDISKVLAISRVMVAWQPIGISMGVFDV
CHRYLKERKQFGVPLVAFQLNQEKLVRMLGNIQAMLLVGWRLCKLYESGKMTPGHASLGK
GWTSRMAREVVSLGRELLGGNGILADFLVAKAFCDLEPIYSYEGTYDINSLVTGREITGI
ASFKPAALAKARL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagcaaggagatgggcgcgaggaggatggcgctaaggtcggcctcccggcg
ctggatatctcgctcgcgtttccgcaggccacgccggcatccatcttcccgccatcagca
tcggactattatcagattgatgatttactcaccactgaagagcagtctatcaggaagaat
gtcagggctataatggagaaagaaattgcacccattatggcaacgtactgggagaaagca
gagttcccatttcatgccattcctaaactttcaagcctcggtgtagctggaggcacaata
aagggatatgggtgcccaggactttcaataacagcaagtgctattactatggcagaaatt
gcacgggtagatgcaagctgctccacgttcattctagtacactcctcccttgcaatggtc
acaatagctctttgtggatctgaggttcagaagcagaagtacttgccatcccttgctcaa
cttactgctgttggttgctgggcattgacagaaccaaatcatggaagcgatgcaagctct
ttgataactacagcaaccaaggtacctggtgggtggcacatagatggacaaaaacgctgg
attggtaacagtacttttgctgatgtgctcgtggtattagctaggaatgccaatacaaaa
caactaaatggatttattgtgaggaagggtgctcctggcttgaaagctacaaagattgag
aacaaaattggtctcagaatggttcagaacggtgatatagtttttaataaagtatttgtc
cctgaggaagatcgactgccaggtgtcaattcatttcaggatataagcaaggtccttgct
atttcacgtgtcatggtggcatggcaaccgattggtatatcaatgggggtgtttgatgtc
tgccatcggtatctgaaagaaaggaaacagtttggagttcctctagtagcttttcagctg
aaccaagaaaaacttgtgcgaatgcttggtaacatccaagcgatgcttcttgttggctgg
cgactatgcaagctttatgagtcagggaaaatgacaccagggcatgctagtttagggaag
ggttggacttccagaatggctcgtgaggtggtttctctcggtcgagaattgttgggtgga
aatggaattttggctgattttctagttgcaaaggcattctgtgacctggagcctatatac
tcatacgaaggcacatacgacatcaacagcctggtgactggtagagaaataactgggatc
gcaagcttcaaacctgccgcattagcaaaagctcggttataa

DBGET integrated database retrieval system