KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324160Help
Entry
4324160           CDS       T01015                                 

Definition
(RefSeq) NADPH-dependent diflavin oxidoreductase 1 isoform X1
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 4324160
NCBI-ProteinID: XP_015621372
UniProt: Q5JL61
Position
1
AA seq 626 aa AA seqDB search
MAATPAADSRLLVIYASETGNAMDAAERVGRQAERGGCPAVDVLPMDSFDPSCLPSERFV
VFVVSTTGQGDPPDSMKGFWRYLLKKNLGARWLEGVRYAVFGLGDSGYQKYNFAAKKLDK
RLLHLGAEPIIQVGLGDDQHPSGYEGALDPWLLSLWESLNQTTPSLLPRMYDIINPDLSV
LGDAKVEVIYHSSDEAQQDSNLLDFKNLIQRARSMSPSLQFYNNDKEPHYMLQMVSNRCL
TKENSDRDVRHFELENPSSGITYQVGDALEILPSQSPSAVDSFIERCKLDPDCYITVRAK
DRVKISKGSLLKDRIKLKTFVALTMDVASASPRRYFFEVMSFFATAEHEKEKLQYFASPE
GRDDLYQYNQKEGRTILEVLDDFPSVQMPFEWLVQLTPPLKKRAFSISSSPLAKPNQIHL
TVSIVSWRTPFKRMRRGLCSSWLAGLNPNEENLIPCWVHHGSLPPPHPSTPLILIGPGTG
CAPFCAFVAERAAQSTSEATAPILFFFGCRNQENDFLYKDFWYAHAHDQGVLSSKNGGGF
FVAFSRDQPQKVYVQHRIREQSARVWNLLKSGAAIYIAGSSTKMPADVTAALEEVICQET
GCSEEEASIWLRKLERNGKFHTETWS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactccggcggcggacagccgcctcctcgtcatatacgcctcggagactggg
aacgctatggacgccgccgaacgggtcggccgccaggccgagcgcggcggctgcccggcc
gtcgacgtcctccccatggacagcttcgaccccagttgccttccgagcgagaggttcgtg
gtcttcgtcgtgtccaccacggggcagggtgatcccccggattccatgaaggggttttgg
aggtaccttcttaagaagaatttgggtgctaggtggcttgaaggggtcagatatgctgtg
tttgggctcggagattcaggctatcagaagtacaattttgctgcaaaaaagctcgataaa
aggcttttacaccttggtgcagaaccaatcatacaggtaggcttgggagatgatcaacac
ccttcaggatatgaaggagctctagatccctggttgctgtctttgtgggaatcactgaat
caaacaactccatcgctgttaccaagaatgtatgatatcattaatccagatttgagtgtc
ttaggagatgcaaaagtcgaagtcatctatcactcttctgacgaggctcaacaagattct
aaccttttggatttcaagaatttaattcagagagcgcgctcaatgtccccttctctacag
ttctataataatgacaaagaaccacattacatgttacagatggtatcaaatcggtgtttg
actaaggaaaattctgacagagacgtgcgccactttgaactggaaaatccatcttctggc
atcacttatcaagttggcgacgcgctagaaattctaccaagtcagagtccatcagctgtt
gactctttcattgaacgctgtaaattggatccagattgttacataacggttcgagccaag
gacagggttaaaatttccaaaggttcacttttgaaagatcgtatcaagttaaaaaccttt
gttgctttgacaatggatgtcgcatcagcttcccctcggcgatatttctttgaggtcatg
agcttttttgcaacggctgaacatgaaaaggaaaagcttcagtattttgcatctccggaa
ggaagagatgacctttatcagtacaatcaaaaggagggccgaactattctagaagtattg
gatgattttccctctgtacaaatgccttttgaatggttggtgcaactaacgcctccatta
aagaaaagagccttttccatatcatcatctccattagcaaaaccaaatcaaatacacttg
actgttagcatagtgtcatggcgtactcctttcaaaaggatgcggcggggtctctgctct
tcatggctggctgggctaaatccaaatgaagaaaatcttataccatgttgggtacaccac
ggttctttgcctcctccacatccatcgactccacttattcttattggaccaggaactgga
tgtgcaccattctgtgcatttgttgcggaaagggctgcacagagtacatcagaagcaaca
gcacccattctattcttctttggctgtagaaatcaagaaaatgattttctatacaaggac
ttctggtatgctcatgcccatgaccagggggtattgtcctcgaaaaatggcggtggtttc
tttgttgccttttctagagatcagcctcaaaaagtctatgtgcagcacaggataagggag
cagagtgcaagagtgtggaatttactaaagtctggggctgcaatatacattgcaggctcg
tctaccaaaatgccagctgatgttacagctgcactggaagaagttatctgtcaagaaacc
ggttgttcagaagaggaagcctcgatatggctcaggaaactagaaaggaacggcaaattt
cacactgagacctggtcatag

DBGET integrated database retrieval system