KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324384
Entry
4324384           CDS       T01015                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa04016  MAPK signaling pathway - plant
osa04070  Phosphatidylinositol signaling system
osa04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:osa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    4324384
   04070 Phosphatidylinositol signaling system
    4324384
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    4324384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:osa01009]
    4324384
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:osa04131]
    4324384
   03036 Chromosome and associated proteins [BR:osa03036]
    4324384
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:osa04147]
    4324384
Protein phosphatases and associated proteins [BR:osa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     4324384
Membrane trafficking [BR:osa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    4324384
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     4324384
Exosome [BR:osa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   4324384
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_11 UPF0154 EFhand_Ca_insen Dockerin_1 Caleosin RNA_pol_Rpb4 DUF5580 MotA_activ DUF6279 Poly_export SurA_N_2 SurA_N_3 Fe_hyd_lg_C MecA_N RTX_C
Other DBs
NCBI-GeneID: 4324384
NCBI-ProteinID: XP_015622341
UniProt: Q0JNS6
Position
1:complement(9195526..9198964)
AA seq 149 aa
MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQINYEEFVKVMMAK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcggaccagctcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc
gacaaggacggcgacggctgcatcaccaccaaggagcttggaactgtgatgcgctcatta
gggcagaaccccactgaggctgagcttcaggacatgatcaacgaggtggatgctgatgga
aatggaacgattgactttcctgagtttctcaacctgatggcacgcaagatgaaggacact
gattctgaggaggagctcaaggaagccttccgtgtatttgacaaggaccagaatggcttc
atctcggcagctgaactccgtcatgtcatgaccaaccttggtgagaagcttacagacgag
gaggtggacgagatgatccgtgaggctgatgtcgatggtgatggtcagatcaattacgaa
gaattcgtgaaggtgatgatggccaagtga

DBGET integrated database retrieval system