KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324441
Entry
4324441           CDS       T01015                                 
Name
(RefSeq) 60S ribosomal protein L30
  KO
K02908  large subunit ribosomal protein L30e
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa03010  Ribosome
Brite
KEGG Orthology (KO) [BR:osa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    4324441
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:osa03011]
    4324441
Ribosome [BR:osa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    4324441
  Archaea
    4324441
SSDB
Motif
Pfam: Ribosomal_L7Ae Hydrolase_6
Other DBs
NCBI-GeneID: 4324441
NCBI-ProteinID: XP_015622112
UniProt: Q9SDG6
Position
1:complement(9658135..9661326)
AA seq 111 aa
MVAAKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSKAKLVIISNNCPPLRKSEI
EYYAMLAKVTVHHFHGNNVDLGTACGKYFRVCCLSIIDPGDSDIIKTTGEQ
NT seq 336 nt   +upstreamnt  +downstreamnt
atggtggccgcaaagaagacgaagaagtccacggacaacatcaacaacaagctgcagctc
gtgatgaagagcggcaagtacacgctcggctacaagaccgtcctcaggaccctcaggaac
tccaaggcgaagctagtgatcatttctaacaactgcccacctcttcggaagtcagaaatt
gagtactacgctatgttggccaaggtcaccgtccaccatttccacggaaataatgtcgat
ctggggacagcctgtggtaaatacttccgtgtttgctgcctcagcattattgatcctggt
gactcggatatcatcaagaccacgggtgagcagtaa

DBGET integrated database retrieval system