KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324573
Entry
4324573           CDS       T01015                                 

Name
(RefSeq) vacuolar cation/proton exchanger 1a
  KO
K07300  Ca2+:H+ antiporter
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4324573
Transporters [BR:osa02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   4324573
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 4324573
NCBI-ProteinID: XP_015620208
UniProt: Q769E5
Position
1
AA seq 451 aa
MEAAAAMEAGRKLAARHPHGRSRTAHNMSSSSLRKKSDAALVRKVPVAPLRPLLANLQEV
FLATKLAVLFPAVPLAIAAQCFRFDQVWVFALSLLGLIPLAERVSFLTEQIALYTGPTVG
GLLNATCGNATELIIALFALLKGKIEVVKCSLLGSVLSNLLLVLGTSLFCGGVVNLGARQ
PYDRNQSDVSTALLFLAVLCHSAPLLLRYAVAAGEHSVSATSAAASLDLSRACSFVMLAS
YVAYLFFQLKTHRQLFEPQEVDGGDAGDDDEEPALGFASALFWLALMTAVISVLSEYVVG
TIEPTSQSWGLSVSFISIILLPIVGNAAEHAGAIIFALKNKLDITLGVALGSATQISMFV
VPLSVLVAWIMGVQMDLDFKLLETGSLFMAVLVTAFTLQDGTSHYLKGILLLLCYIVIGA
CFFVARQPAGHANSNGALLDVPTGSMSVQAA
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggaggcggcggcggcgatggaggcggggcggaagctggcggcgcggcacccgcacggg
cggagcaggacggcgcacaacatgtcgtcgtcgtcgctgcggaagaagtcggacgccgcg
ctggtgcggaaggtccccgtggcgccgctccgcccgctgctcgccaacctccaggaggtc
ttcctcgccaccaagctcgccgtcctcttccccgccgtcccgctcgccatcgccgcccag
tgcttccgcttcgaccaggtgtgggtgttcgctcttagtttactgggcctcatccctctc
gccgagagagtcagcttcctcacagagcagattgcactctacaccggtcccaccgtgggc
gggctgctgaacgcgacgtgcgggaacgcgacggagctgatcatcgcgctgttcgcgctg
ctcaaggggaagatcgaggtggtcaagtgctccctgctgggctccgtcctctccaacctc
ctcctcgtcctcggcacctccctcttctgcggcggcgtcgtcaacctcggcgcccgccag
ccctacgaccgcaaccagtccgacgtcagcaccgccctcctcttcctcgccgtcctctgc
cactccgccccgctcctcctccgctacgccgtcgccgctggcgagcactccgtctccgcc
acctcggccgcggcgtccctcgacctctcccgcgcctgcagcttcgtcatgctggcgtcc
tacgtcgcctacctcttcttccagctcaagacgcaccgccagctgttcgagccgcaggag
gtggacggcggcgacgccggggacgacgacgaggagccggcgctcgggttcgccagcgcg
ctcttctggctcgccctcatgaccgccgtcatctccgtcctctccgagtacgtcgtcggc
accatcgagcccacctcgcagtcatggggcctctccgtcagcttcatcagcatcatcctc
ctccccatcgtcggcaacgccgccgagcacgccggcgccatcatcttcgcgctcaagaac
aagctggacatcactcttggggtagctctgggatcggccacccagatatccatgttcgtg
gtgccactgagtgtgctcgtggcctggatcatgggggtccaaatggatcttgacttcaag
ctgctagagaccggctctctgttcatggcggtgctggtgacggccttcaccctgcaggat
ggaacatcacattacctgaaggggattctcctcctcctgtgctacattgtcatcggcgca
tgttttttcgttgcaagacaacctgcaggccatgcaaacagcaatggagccttgctggat
gtaccaaccggttccatgagtgttcaggccgcatga

DBGET integrated database retrieval system