KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324864Help
Entry
4324864           CDS       T01015                                 

Definition
(RefSeq) endoribonuclease Dicer homolog 3a isoform X1
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Brite
KEGG Orthology (KO) [BR:osa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:osa03036]
    4324864
Enzymes [BR:osa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     4324864
Chromosome and associated proteins [BR:osa03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    4324864
   microRNA pathway
    RISC loading complex
     4324864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Ribonucleas_3_3 Dicer_dimer Helicase_C PAZ ResIII DEAD PCDO_beta_N
Motif
Other DBs
NCBI-GeneID: 4324864
NCBI-ProteinID: XP_015621462
UniProt: Q5N870
Position
1
AA seq 1651 aa AA seqDB search
MNPLKRSLESSSQEHEAGKQKLQKRECQDFTPRRYQLDVYEVAMRRNTIAMLDTGAGKTM
IAVMLIKEFGKINRTKNAGKVIIFLAPTVQLVTQQCEVIEIHTDFEVEQYYGAKGVDQWT
GPRWQEQISKYQVMVMTPQVFLQALRNAFLILDMVSLMIFDECHHATGNHPYTRIMKEFY
HKSEHKPSVFGMTASPVIRKGISSHLDCEGQFCELENLLDAKIYTVSDREEIEFCVPSAK
EMCRYYDSKPVCFEDLSEELGVLCSKYDALITELQNKRSDMYKDADDITKESKRRLSKSI
AKICYCLDDVGLICASEATKICIERGQEKGWLKEVVDATDQQTDANGSRLFAENSALHMK
FFEEALHLIDKRLQQGIDMLLNSESGCVEAAKTGYISPKLYELIQIFHSFSNSRHARCLI
FVDRKITARVIDRMIKKIGHLAHFTVSFLTGGRSSVDALTPKMQKDTLDSFRSGKVNLLF
TTDVAEEGIHVPECSCVIRFDLPRTTRSYVQSRGRARQEDSQYILMIERGNVKQNDLISA
IVRSETSMVKIASSRESGNLSPGFVPNEEINEYHVGTTGAKVTADSSISIVYRYCEKLPQ
DKCYSPKPTFEFTHHDDGYVCTLALPPSAVLQILVGPKARNMHKAKQLVCLDACKKLHEL
GALDDHLCLSVEDPVPEIVSKNKGTGIGTTKRKELHGTTRIHAWSGNWVSKKTALKLQSY
KMNFVCDQAGQIYSEFVLLIDATLPDEVATLEIDLYLHDKMVKTSVSSCGLLELDAQQME
QAKLFQGLLFNGLFGKLFTRSKVPNAPREFILNKEDTFVWNTASVYLLLPTNPSFDSNVC
INWSVIDAAATAVKLMRRIYSENKRELLGIFDSDQNVGDLIHLANKSCKANSLKDMVVLA
VHTGKIYTALDITELSGDSAFDGASDKKECKFRTFAEYFKKKYGIVLRHPSQPLLVLKPS
HNPHNLLSSKFRDEGNVVENMSNGTPVVNKTSNRVHMPPELLIPLDLPVEILRSFYLFPA
LMYRIESLTLASQLRSEIGYSDSNISSFLILEAITTLRCSEDFSMERLELLGDSVLKYAV
SCHLFLKFPNKDEGQLSSIRCHMICNATLYKLGIERNVQGYVRDAAFDPRRWLAPGQLSI
RPSPCECPVKSEVVTDDIHIIDDKAIVLGKACDKGHRWMCSKTIADCVEAIIGAYYAGGG
LRAAMAVLKWLGIGAEIEEDLIVQAILSASVQTYLPKDNVFEMLEAKLGYSFSVKGLLVE
ALTHPSQQELGAKYCYERLEFLGDAVLDILLTRYLFNSHKDTNEGELTDLRSASVNNENF
AQVAVKHNFHHFLQHSSGLLLDQITEYVNRLEGSSMDKVELLSDGLPKGPKVLGDIVESI
AGAILLDTKLDLDVVWGIFEPLLSPIVTPENLELPPYRELIEWCGKHGYFVGINCRDQGD
TVVATLDVQLKEVLLVRQGFSKKRKDAKAHASSLLLKDLEEKGLIIPKNASKTEQFEKHC
GSTNPFNNLHVDAMDTQTPKPTKEKNAADSRNISDPLLGKPLHVIVKTSKGGPRIALYEL
CKKLQWPMPTMESEKVQPSFSSVCSSPGGSSQKATPQAFAFASTITLHIPNADVISLTGD
GRADKKSSQDSAALFLLYELQRRGTLQLQEV
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctttaaagaggtcattggaatcatcttctcaggaacatgaagcaggcaaacag
aaactgcagaagagagagtgtcaagatttcactcccagaagatatcagcttgatgtctat
gaggttgcaatgcggagaaacacgattgcgatgcttgacacaggagccgggaagacaatg
attgctgtgatgcttatcaaggagttcggaaagataaacagaacaaagaatgctggaaaa
gtcatcatatttcttgcaccaacagttcaacttgttacacagcaatgcgaggtgattgaa
atccacacagattttgaggtagaacaatactatggtgcaaagggggttgatcaatggaca
ggtcctagatggcaagagcaaatctcaaaataccaggtcatggtcatgacaccacaggtg
ttcctacaagctttacgcaatgctttcttaatcttggacatggttagtctcatgatattt
gatgaatgccatcatgcaactggaaaccacccttatacaagaataatgaaggagttctat
cacaaatcagaacataagccaagtgtgtttggtatgacagcatcacctgttataagaaaa
ggtatctcttctcatttggattgtgaaggtcagttctgtgaattggagaacctgttagat
gctaagatctacacagtttcagatagagaagagatagagttttgtgttccttctgcaaaa
gaaatgtgcaggtactatgactcgaaaccagtttgttttgaagatttgagtgaagaattg
ggagttttatgttccaagtatgatgcattgataacagagttgcagaataagcgaagcgac
atgtataaagatgctgatgatataacaaaagaatcaaagagacgcctttctaaatctata
gcaaaaatttgctactgccttgatgatgttggtcttatttgtgcaagtgaggccacaaaa
atctgcattgaaaggggccaggagaaaggttggctgaaggaagtagttgatgccacagat
cagcaaactgatgcaaatggatcacgcctatttgcagaaaattcagcgcttcatatgaag
ttctttgaggaagccttgcatttaattgacaaacgcctccaacaaggtatcgacatgctt
ctaaactcagaaagtggatgtgttgaagcagcaaagacgggctatatttccccaaagctc
tatgaactcatccagatctttcactcttttagtaactctcgtcatgctcgatgcctcatt
tttgttgatcgaaagatcactgctagagtcattgaccggatgattaagaaaattggccac
cttgcacatttcacagtttcttttcttactggagggagatcttcggtggatgctctgaca
cccaaaatgcagaaggatacattggattcatttcgctctggaaaggtgaacttactattt
actacagatgttgctgaagagggtatccatgtcccagaatgctcttgtgtaatacgattt
gatttgccaaggacaacacgtagctatgtgcagtcacgtggacgagcacgccaggaagac
tctcagtacattctcatgattgaacgggggaacgtgaagcaaaatgatttgatatctgca
attgtgagaagtgagacttcaatggttaagattgcttcaagcagagagtctggaaatctg
tcgcctggttttgttcccaatgaagaaataaacgaataccatgtaggcacaacaggagcg
aaagtaactgctgattcaagcatcagtattgtctaccgatactgtgagaagcttccgcag
gataagtgctactccccaaaacctacatttgagttcactcatcatgatgatggatatgtg
tgtacattagcattaccaccaagtgctgtgcttcaaattctggtgggcccaaaagcaaga
aacatgcacaaagcaaaacagctcgtttgccttgatgcatgtaagaagttgcatgagcta
ggagcacttgatgaccacctttgtctatctgttgaagatccagttccagaaattgtaagc
aaaaataagggtactggtataggtacaaccaaacggaaggagctacatggtacaacaaga
attcatgcttggtctggcaattgggtgtcaaagaaaactgcactcaagcttcaaagctac
aaaatgaattttgtttgtgaccaagctggtcagatttactctgaatttgttctgttaatt
gatgcaactttaccggatgaagtcgctactttggagattgacctatatttgcacgacaag
atggtcaaaacttcagtttcttcttgtggacttcttgagttggatgctcaacagatggaa
caagcaaagttgtttcaagggcttctcttcaatggtttgtttggaaagctgtttactaga
tcaaaagtacctaatgctccgagggaattcattcttaataaagaggatacatttgtgtgg
aacactgcgagtgtatatttgcttttaccaacaaatccttcttttgactccaacgtttgt
attaattggagtgtcattgatgcggcagctacggcagttaaacttatgagaaggatttat
tctgagaataaaagagaattacttggaatatttgattctgaccaaaatgttggagattta
attcatttagctaacaagtcgtgtaaggctaacagcctcaaagatatggtagttctagca
gttcacactgggaagatatatactgctcttgatattactgaattatctggcgatagcgct
tttgatggtgcatctgataagaaagaatgtaaattccggacattcgcagaatatttcaaa
aagaagtatggcatagtacttcgccacccctcacagccactactagttttgaagcctagt
cataatcctcacaaccttctttcctcgaagttcagggatgaaggtaatgttgtggagaat
atgagtaatggcacaccagttgtaaataaaacaagcaaccgtgtccacatgcctcctgag
ttgctgattccccttgatttacctgtggaaattttgagatcattctatttgtttccggct
ttgatgtatcggattgagtcattaacgttagctagtcaactaagaagtgaaattggatac
agcgattctaatatatcaagtttcctgattctggaagctattacaacgcttaggtgctct
gaggatttctctatggagcgtctagaattattgggagactctgtattgaagtatgcagtg
agttgtcatcttttcctgaaatttcctaataaggatgaggggcagctatcatccataagg
tgccatatgatttgtaatgccacactttataagcttggaattgaacgcaatgtacagggt
tacgtacgtgatgctgcatttgatcctcgtcgatggctagcaccaggacagctctctatt
cgtccatctccttgtgaatgccctgtaaaatctgaggttgtaactgacgatattcatatc
attgatgacaaggctattgttctaggcaaggcgtgtgacaagggacacagatggatgtgt
tccaaaaccattgctgattgtgttgaggctattattggggcatattatgcagggggtggt
ttaagagcagccatggcagttctcaaatggttgggcatcggggctgaaattgaagaagac
ttgattgtgcaggccatattgagtgcttctgtgcagacttatcttccaaaagacaatgta
tttgaaatgcttgaagcaaaactaggctattctttctcggtgaaaggtcttttggtagag
gctctgactcacccatcacagcaggagttaggtgcaaaatactgctacgagcgcctagag
ttcctcggtgatgcggtcttagacattctgttaacaagatatcttttcaatagtcataaa
gacactaatgagggggagttgacagacttacgttctgcatcagtcaataatgaaaacttt
gcacaagttgcagtaaagcacaacttccatcactttctccagcattcttctgggcttctg
ttagaccaaattactgaatatgtgaataggttggaaggttcatccatggacaaagttgaa
ctgttatcagatggactcccaaaagggcctaaagtccttggtgatattgtagaaagtatt
gcaggtgcaattcttttagacaccaaacttgatttggatgtagtctggggtatttttgaa
ccccttctttccccaattgtcacacctgagaatctggagttacctccatacagagagctt
atcgaatggtgtggcaaacatgggtattttgtaggaattaactgtagagatcaaggagac
acagtagtggctactcttgatgtacagctcaaagaggtgcttcttgtgaggcaaggtttt
agcaagaaaagaaaagatgcgaaagcgcatgcatcttccttactgctcaaagatctcgag
gaaaaaggactaataatcccaaagaatgcaagcaagacagaacaatttgaaaagcattgt
ggcagcactaatcccttcaacaatttgcatgtcgatgcaatggatacacagactccaaaa
ccaaccaaggaaaaaaacgcagctgattcaaggaacatttctgatcccctgcttggtaaa
ccattgcacgtgattgtgaaaacgagtaaaggaggaccacgcattgcattatatgagttg
tgtaaaaagttgcaatggccaatgcctacaatggaatctgagaaagtacaaccaagcttt
agcagcgtgtgctcctcccctggtggttcctctcagaaagctaccccccaagcgttcgct
ttcgcttcaaccattacattgcatataccaaatgctgatgtgatcagcctcacaggagat
ggccgtgcagataagaagagctcacaggattctgctgccctgttcttgctctatgagctt
cagcggcgaggtactttgcaactccaggaggtgtga

DBGET integrated database retrieval system