KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4324880Help
Entry
4324880           CDS       T01015                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 4324880
NCBI-ProteinID: XP_015621279
UniProt: Q8S0R8
Position
1
AA seq 111 aa AA seqDB search
MATFSDAPPGDAAAGEKIFRTKCAYCHAVDKAAGHKHGPNLNGLFGRQSGTAPGFSYPSG
DKIVPVIWEENTLYDYLLTPKKYTPAKMGFNGLKQPQDRADLIAYLKNATA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcgacattctccgatgcgccgcccggggacgcggcggccggcgagaagatcttcagg
accaagtgcgcgtactgccatgccgtcgacaaggccgccggccacaagcatgggccaaac
ttgaacggtttgtttgggaggcaatctggtacagctcctggtttctcttacccatctggc
gacaagatagtgcctgtgatttgggaagagaacactttgtatgactacctgcttactcct
aagaagtacactcctgccaagatggggttcaatggactgaagcagccacaggaccgtgct
gatctcatcgcatacctgaagaacgccacagcatga

DBGET integrated database retrieval system