KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325003Help
Entry
4325003           CDS       T01015                                 

Definition
(RefSeq) gibberellin 20 oxidase 2
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: 2OG-FeII_Oxy DIOX_N
Motif
Other DBs
NCBI-GeneID: 4325003
NCBI-ProteinID: XP_015627721
UniProt: Q0JH50 B6F2D9
Position
1
AA seq 389 aa AA seqDB search
MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAE
LDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFR
LPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGP
DFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEP
ERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRY
KSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRA
DTRTLDAFTRWLAPPAADAAATAQVEAAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccacc
gccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagccc
aagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggag
ctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgc
cgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgag
cacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgc
ctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacacc
agcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggc
ttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggcccc
gacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcg
ctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggag
ttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccg
gagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccag
gacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtc
cccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtat
aagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttc
ttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcag
cactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgcc
gacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgcc
gcgacggcgcaggtcgaggcggccagctga

DBGET integrated database retrieval system