KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325534Help
Entry
4325534           CDS       T01015                                 

Definition
(RefSeq) 14-3-3-like protein GF14-G
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3
Motif
Other DBs
NCBI-GeneID: 4325534
NCBI-ProteinID: XP_015629247
UniProt: Q5QNB8
Position
1
AA seq 257 aa AA seqDB search
MAPSDDLVYMAKLAEQAERYDEMVEAMNSVAKLDEGLTKEERNLLSVGYKNLIGAKRAAM
RIIGSIELKEETKGKESHVRQTAEYRRKVEAEMDKICCDVINIIDKYLIPHSSGAESSVF
YYKMKGDYYRYLAEFKTGTEKIEVSELSLNAYETASKTAQTDLTPTDPIRLGLALNISVF
YCEIMNSPDKACQLAKNAFDEAVAELPSLSEENYKDSTLIMQLLRDNLALWNSDMADDAD
DIRERTDTTGAKGDPAA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagcgacgacctcgtctacatggccaagctcgccgagcaggccgagcgatac
gacgagatggtggaggcaatgaatagtgtggcaaagttagacgaggggctgacaaaggag
gagaggaacctcctctcagttggctacaagaatttgattggtgcaaagcgtgcggcaatg
cgtatcattggatccattgagctaaaggaggagacaaagggcaaggagagtcatgtaagg
cagactgctgagtatcgtcgcaaggtggaggctgagatggataaaatctgctgtgatgtc
ataaacattattgacaagtaccttatcccacattcctctggagctgagagctcagtcttc
tactacaaaatgaagggagattactaccggtaccttgcagagttcaagactgggactgag
aagattgaagtgtctgaactgtcactcaatgcttatgagactgcttccaaaactgcgcag
acagatctcactccaactgaccctatcagacttggtttagctctgaatatatctgtcttc
tactgtgagatcatgaactcacctgacaaagcttgccaacttgctaagaacgcctttgat
gaagctgttgcggagcttccctccctcagtgaggagaattacaaagatagtacactgatc
atgcaacttctgagggataatctagcactgtggaattctgatatggctgatgatgcagac
gatattagggaacgaacagatacaactggtgctaaaggtgaccctgcagcgtga

DBGET integrated database retrieval system