KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4325704
Entry
4325704           CDS       T01015                                 
Name
(RefSeq) glutathione S-transferase 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00480  Glutathione metabolism
osa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4325704
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:osa02000]
    4325704
Enzymes [BR:osa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4325704
Transporters [BR:osa02000]
 Other transporters
  Pores ion channels [TC:1]
   4325704
SSDB
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_5
Other DBs
NCBI-GeneID: 4325704
NCBI-ProteinID: XP_015622486
UniProt: A0A0P0V353 Q5ZC86
Position
1:complement(15170432..15171884)
AA seq 240 aa
MYQQSAGQIQLQEGPMAPMKVYGWVVSPWMARVLVALEEAGAEYEVVPMSRSGGDHRRPE
HLARNPFGEIPVLEDGDLTLYQSRAIARYIFRKYKPEFLGLGEGGSLEESAMVDVWLDVE
AHQHEAAVRPILWHCIINKFEGRDRDQGVVDESVRKLEKVLGVYEARLSGSRYLAGDRIS
LADLSHFSNMRYFMATEYAGVVDAYPHVKAWWEALLARPTVQKVMAGMPPDFGFGSGNIP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgtaccaacaaagtgcagggcaaattcagctgcaagaaggaccaatggcgccgatgaaa
gtgtacgggtgggtggtatcgccatggatggcgcgggtgctggtggccctggaggaggcc
ggcgccgagtacgaggtcgttccgatgagcaggtccggcggcgaccaccgccggccggag
cacctcgccagaaacccgttcggtgagattccagtactggaggatggcgacctgacgctc
tatcaatcgcgagcaatcgctaggtacatctttcgcaagtacaaaccagagttcctggga
ctcggagaaggtggaagcctggaggagtcggcaatggtggacgtgtggctggacgtggaa
gcccaccagcacgaggccgccgtgaggcccatcctgtggcactgcatcatcaacaagttc
gagggccgcgaccgcgaccagggcgtcgtggacgagagcgtccggaagctggagaaggtg
ctcggggtgtacgaggcgaggctgtcgggctccaggtacctcgccggcgaccgcatcagc
ctcgcggacctcagccacttctccaacatgcgctacttcatggcgacggagtacgccggc
gtggtcgacgcgtacccgcacgtgaaggcgtggtgggaggcgctgctggccaggccgacg
gtgcagaaggtgatggccggcatgccaccggatttcggcttcggaagtgggaacatacca
tag

DBGET integrated database retrieval system